KEGG   Bos indicus (zebu cattle): 109567428
Entry
109567428         CDS       T04792                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu04012  ErbB signaling pathway
biu04015  Rap1 signaling pathway
biu04062  Chemokine signaling pathway
biu04137  Mitophagy - animal
biu04144  Endocytosis
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04510  Focal adhesion
biu04520  Adherens junction
biu04530  Tight junction
biu04540  Gap junction
biu04611  Platelet activation
biu04625  C-type lectin receptor signaling pathway
biu04727  GABAergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04810  Regulation of actin cytoskeleton
biu04912  GnRH signaling pathway
biu04915  Estrogen signaling pathway
biu04917  Prolactin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu04921  Oxytocin signaling pathway
biu04926  Relaxin signaling pathway
biu05100  Bacterial invasion of epithelial cells
biu05135  Yersinia infection
biu05152  Tuberculosis
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05219  Bladder cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109567428 (SRC)
   04015 Rap1 signaling pathway
    109567428 (SRC)
   04370 VEGF signaling pathway
    109567428 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109567428 (SRC)
   04137 Mitophagy - animal
    109567428 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109567428 (SRC)
   04520 Adherens junction
    109567428 (SRC)
   04530 Tight junction
    109567428 (SRC)
   04540 Gap junction
    109567428 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109567428 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109567428 (SRC)
   04625 C-type lectin receptor signaling pathway
    109567428 (SRC)
   04062 Chemokine signaling pathway
    109567428 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    109567428 (SRC)
   04915 Estrogen signaling pathway
    109567428 (SRC)
   04917 Prolactin signaling pathway
    109567428 (SRC)
   04921 Oxytocin signaling pathway
    109567428 (SRC)
   04926 Relaxin signaling pathway
    109567428 (SRC)
   04919 Thyroid hormone signaling pathway
    109567428 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    109567428 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109567428 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    109567428 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109567428 (SRC)
   05203 Viral carcinogenesis
    109567428 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    109567428 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109567428 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109567428 (SRC)
   05152 Tuberculosis
    109567428 (SRC)
   05100 Bacterial invasion of epithelial cells
    109567428 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109567428 (SRC)
   05168 Herpes simplex virus 1 infection
    109567428 (SRC)
   05163 Human cytomegalovirus infection
    109567428 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109567428 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109567428 (SRC)
   01522 Endocrine resistance
    109567428 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109567428 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109567428 (SRC)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     109567428 (SRC)
Protein kinases [BR:biu01001]
 Non-receptor tyrosine kinases
  SRC family
   109567428 (SRC)
Membrane trafficking [BR:biu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    109567428 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    109567428 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    109567428 (SRC)
  Macropinocytosis
   Kinases
    109567428 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3
Other DBs
NCBI-GeneID: 109567428
NCBI-ProteinID: XP_019827944
UniProt: A0A6P5CRT2
LinkDB
Position
13
AA seq 542 aa
MGSNKSKPKDASQRXRSLESAENTHGGGGGGGGGGGAFPSSQTPSKPASSDGHRGPNTAF
APAAAEPKLFGGFNSSDTVTSPQRAGPLSGGVTTFVALYDYESRTETDLSFKKGERLQIV
NNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGT
FLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYS
KHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTR
VAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLK
GETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGESLVCKVADFGLARLI
EDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREV
LDQVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGE
NL
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccagcgnngccgcagcctggagtct
gcygagaacacccacggaggcggcggcggcggcggcggcggtgggggtgccttcccctcc
tcacagacccccagcaagccagcctcctctgatggccaccgcggccccaacacggccttc
gcccctgcagccgctgagcccaagctgttcggaggcttcaactcctcggacacagtcacc
tccccgcagagggcggggcccctgtctggcggagtgaccaccttcgtggccctctatgac
tatgagtcgcggacagagactgacctgtctttcaagaaaggggagcggcttcagattgtc
aacaacacagagggagactggtggctggcccactcgctcagcacaggacagacrggctac
atccccagcaactacgtggcaccctctgactccatccaggctgaagagtggtactttggc
aagatcaccagacgggagtcagagcggttactgctcaatgcagagaacccaagagggacc
ttcctagtgcgagaaagcgagaccacgaaaggcgcctactgcctctcggtgtctgacttc
gacaacgccaagggcctcaacgtgaagcactacaaaatccgcaagctggacagcggaggc
ttctacatcacctcccgcacccagttcaacagcctgcagcagctggtggcctactactcc
aaacacgctgacggcctctgccaccgcctcaccactgtgtgccccacgtccaagccgcag
actcaaggcytggccaaagatgcctgggagatcccccgggagtcgctgcggctggaggtc
aagctgggccagggctgcttcggagaggtgtggatgggtacctggaacggcaccaccagg
gtggccatcaaaaccctgaagcctggtacgatgtctccggaggccttcctgcaggaggcc
caggttatgaagaaactgaggcatgaaaaactcgtgcagctgtacgccgtggtgtccgaa
gagcccatctacattgtcacggagtacatgagcaaggggagtttgctggactttctcaag
ggggagacaggcaagtacctgcggctgcctcagctggtggacatggctgcacagatcgcc
tcaggcatggcttatgtggaacggatgaactatgtccaccgagacctccgggctgccaac
atcctggttggagagagcctcgtatgcaaagtggctgacttcgggctggctcgactcatt
gaagacaacgaatacacagcccggcaaggtgccaaattccccatcaagtggacagctccg
gaagctgccctctatggccggttcaccatcaaatcagacgtgtggtcctttgggatcctg
ctgacggagctcacaacaaagggacgggtgccctaccctgggatggtgaaccgggaggtg
ctggaccaggtggagcggggctaccggatgccctgccctcctgagtgtcccgagtcattg
catgacctgatgtgccagtgctggcggaaggacccggaggaacggcccaccttcgagtac
ctgcaggccttcctggaggactatttcacgtccaccgagccccagtaccagcccggagag
aacctatag

DBGET integrated database retrieval system