Bos indicus (zebu cattle): 109567832 Help Entry 109567832         CDS       T04792                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism biu  Bos indicus (zebu cattle) Pathway biu04080   Neuroactive ligand-receptor interaction biu04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     109567832 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     109567832 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109567832 (GHRH) Cytokines and neuropeptides [BR:biu04052]  Neuropeptides   Neuropeptides (GPCR binding)    109567832 (GHRH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_2 Ret2_MD Motif Other DBs NCBI-GeneID:  109567832 NCBI-ProteinID:  XP_019828406 UniProt:  A0A6P5CQS6 LinkDB All DBs Position 13:complement(66807172..66816536) Genome browser AA seq 106 aa AA seqDB search MLLWVFFLVTLTLSSGSHGSLPSQPLRIPRYADAIFTNSYRKVLGQLSARKLLQDIMNRQ QGERNQEQGAKVRLGRQVDGVWTDQQQMALESTLVSLLQERRNSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcctcgtgaccctcaccctcagcagcggctcccacggttcc ctgccttcccagcctctcaggattccacggtacgcagatgccatcttcactaacagctac cggaaggttctgggccagctgtctgcccgcaagctactccaggatatcatgaacaggcag cagggagagagaaaccaggagcaaggagcaaaggtacggcttggccgtcaggtggacggc gtgtggacagaccaacagcagatggcactggagagcaccttggtgagcctgctgcaggag cgcaggaattcccaaggatga

DBGET integrated database retrieval system