Bos indicus (zebu cattle): 109568081 Help Entry 109568081         CDS       T04792                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism biu  Bos indicus (zebu cattle) Pathway biu04014   Ras signaling pathway biu04015   Rap1 signaling pathway biu04020   Calcium signaling pathway biu04022   cGMP-PKG signaling pathway biu04024   cAMP signaling pathway biu04070   Phosphatidylinositol signaling system biu04114   Oocyte meiosis biu04218   Cellular senescence biu04261   Adrenergic signaling in cardiomyocytes biu04270   Vascular smooth muscle contraction biu04371   Apelin signaling pathway biu04625   C-type lectin receptor signaling pathway biu04713   Circadian entrainment biu04720   Long-term potentiation biu04722   Neurotrophin signaling pathway biu04728   Dopaminergic synapse biu04740   Olfactory transduction biu04744   Phototransduction biu04750   Inflammatory mediator regulation of TRP channels biu04910   Insulin signaling pathway biu04912   GnRH signaling pathway biu04915   Estrogen signaling pathway biu04916   Melanogenesis biu04921   Oxytocin signaling pathway biu04922   Glucagon signaling pathway biu04924   Renin secretion biu04925   Aldosterone synthesis and secretion biu04970   Salivary secretion biu04971   Gastric acid secretion biu05010   Alzheimer disease biu05012   Parkinson disease biu05022   Pathways of neurodegeneration - multiple diseases biu05031   Amphetamine addiction biu05034   Alcoholism biu05133   Pertussis biu05152   Tuberculosis biu05163   Human cytomegalovirus infection biu05167   Kaposi sarcoma-associated herpesvirus infection biu05170   Human immunodeficiency virus 1 infection biu05200   Pathways in cancer biu05214   Glioma biu05417   Lipid and atherosclerosis biu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     109568081    04015 Rap1 signaling pathway     109568081    04371 Apelin signaling pathway     109568081    04020 Calcium signaling pathway     109568081    04070 Phosphatidylinositol signaling system     109568081    04024 cAMP signaling pathway     109568081    04022 cGMP-PKG signaling pathway     109568081  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     109568081    04218 Cellular senescence     109568081  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109568081   09152 Endocrine system    04910 Insulin signaling pathway     109568081    04922 Glucagon signaling pathway     109568081    04912 GnRH signaling pathway     109568081    04915 Estrogen signaling pathway     109568081    04921 Oxytocin signaling pathway     109568081    04916 Melanogenesis     109568081    04924 Renin secretion     109568081    04925 Aldosterone synthesis and secretion     109568081   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     109568081    04270 Vascular smooth muscle contraction     109568081   09154 Digestive system    04970 Salivary secretion     109568081    04971 Gastric acid secretion     109568081   09156 Nervous system    04728 Dopaminergic synapse     109568081    04720 Long-term potentiation     109568081    04722 Neurotrophin signaling pathway     109568081   09157 Sensory system    04744 Phototransduction     109568081    04740 Olfactory transduction     109568081    04750 Inflammatory mediator regulation of TRP channels     109568081   09159 Environmental adaptation    04713 Circadian entrainment     109568081  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109568081   09162 Cancer: specific types    05214 Glioma     109568081   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109568081    05163 Human cytomegalovirus infection     109568081    05167 Kaposi sarcoma-associated herpesvirus infection     109568081   09171 Infectious disease: bacterial    05133 Pertussis     109568081    05152 Tuberculosis     109568081   09164 Neurodegenerative disease    05010 Alzheimer disease     109568081    05012 Parkinson disease     109568081    05022 Pathways of neurodegeneration - multiple diseases     109568081   09165 Substance dependence    05031 Amphetamine addiction     109568081    05034 Alcoholism     109568081   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109568081    05418 Fluid shear stress and atherosclerosis     109568081  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:biu01009]     109568081   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:biu04131]     109568081    03036 Chromosome and associated proteins [BR:biu03036]     109568081   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:biu04147]     109568081 Protein phosphatases and associated proteins [BR:biu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      109568081 Membrane trafficking [BR:biu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     109568081 Chromosome and associated proteins [BR:biu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      109568081 Exosome [BR:biu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109568081 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 EF-hand_4 SPARC_Ca_bdg DUF5580_M EF-hand_11 UPF0154 EF-hand_14 SurA_N_3 TerB SurA_N_2 Dockerin_1 Phage_TAC_12 ExbD Fe_hyd_lg_C Motif Other DBs NCBI-GeneID:  109568081 NCBI-ProteinID:  XP_019828868 UniProt:  A0A6P5CTG9 LinkDB All DBs Position 13:43540925..43541758 Genome browser AA seq 148 aa AA seqDB search MAEKLSEEQVAEFKEAFDRFDKNKDGTISVQELGTVMQEVGLKLSEAELKKLISQLDTDK NGSISFQEFLEAMAAGLQTSDTEGLREIFRAFDQDDDGYISVDELRQATSQLGEKVSQDE LDAMIREADVDQDGRVNYEEFVRILTQN NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcagaaaagctgtccgaagagcaggtggcggagttcaaggaggccttcgacaggttc gacaagaacaaggatggcaccatcagtgtgcaggagctgggcaccgtgatgcaggaggtg ggcctgaagctgtcagaggctgagctgaagaagctcatctcccagctggacacggacaag aacggcagcatcagcttccaggagttcctggaggccatggccgcagggcttcagacctca gacacggagggcctgagggaaatcttccgtgccttcgaccaggacgacgatggctacatc agcgtggacgagctcaggcaggccacatcccagctgggggagaaggtgtctcaggacgag ctggacgccatgatccgggaggcggacgtggaccaagacggccgggtgaactatgaggaa ttcgtgcgcatcctcacccagaactga

DBGET integrated database retrieval system