Bos indicus (zebu cattle): 109571028 Help Entry 109571028         CDS       T04792                                  Gene name IL2 Definition (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism biu  Bos indicus (zebu cattle) Pathway biu04060   Cytokine-cytokine receptor interaction biu04061   Viral protein interaction with cytokine and cytokine receptor biu04151   PI3K-Akt signaling pathway biu04625   C-type lectin receptor signaling pathway biu04630   JAK-STAT signaling pathway biu04658   Th1 and Th2 cell differentiation biu04659   Th17 cell differentiation biu04660   T cell receptor signaling pathway biu04672   Intestinal immune network for IgA production biu04940   Type I diabetes mellitus biu05135   Yersinia infection biu05142   Chagas disease biu05162   Measles biu05166   Human T-cell leukemia virus 1 infection biu05200   Pathways in cancer biu05320   Autoimmune thyroid disease biu05321   Inflammatory bowel disease biu05330   Allograft rejection biu05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     109571028 (IL2)    04151 PI3K-Akt signaling pathway     109571028 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109571028 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     109571028 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109571028 (IL2)    04660 T cell receptor signaling pathway     109571028 (IL2)    04658 Th1 and Th2 cell differentiation     109571028 (IL2)    04659 Th17 cell differentiation     109571028 (IL2)    04672 Intestinal immune network for IgA production     109571028 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109571028 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     109571028 (IL2)    05321 Inflammatory bowel disease     109571028 (IL2)    05330 Allograft rejection     109571028 (IL2)    05332 Graft-versus-host disease     109571028 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     109571028 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     109571028 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109571028 (IL2)    05162 Measles     109571028 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     109571028 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:biu04052]     109571028 (IL2)    00536 Glycosaminoglycan binding proteins [BR:biu00536]     109571028 (IL2) Cytokines and growth factors [BR:biu04052]  Cytokines   Interleukins    109571028 (IL2) Glycosaminoglycan binding proteins [BR:biu00536]  Heparan sulfate / Haparin   Cytokines    109571028 (IL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 DUF922 Motif Other DBs NCBI-GeneID:  109571028 NCBI-ProteinID:  XP_019832709 UniProt:  Q8HZ67 LinkDB All DBs Position 17 AA seq 145 aa AA seqDB search MYKIQLLSCIALTLALVANGAPTSSSTGNTMKEVKSLLLDLQLLLEKVKNPENLKLSRMH TFDFYVPKVNATELKHLKCLLEELKLLEEVLNLAPSKNLNPREIKDSMDNIKRIVLELQG SETRFTCEYDDATVNAVEFLNKWIT NT seq 436 nt NT seq  +upstreamnt  +downstreamnt atgtacaagatacaactcttgtcttgcattgcactaactcttgcactcgttgcaaacggt gcacctacttcaagctctacggggaacacaatgaaagaagtgaagtcattgctgctggat ttacagttgcttttggagaaagttaaaaatcctgagaacctcaagctctccaggatgcat acatttgacttttacgtgcccaaggttaacgctacagaattgaaacatcttaagtgttta ctagaagaactcaaacttctagaggaagtgctaaatttagctccaagcaaaaacctgaac cccagagagatcaaggattcaatggacaatatyaagagaatcgttttggaactacaggga tctgaaacaagattcacatgtgaatatgatgatgcaacagtaaacgctgtagaatttctg aacaaatggattacct

DBGET integrated database retrieval system