KEGG   Bos indicus (zebu cattle): 109573568
Entry
109573568         CDS       T04792                                 

Gene name
ITGA2B
Definition
(RefSeq) integrin alpha-IIb
  KO
K06476  integrin alpha 2B
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04015  Rap1 signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04512  ECM-receptor interaction
biu04611  Platelet activation
biu04640  Hematopoietic cell lineage
biu04810  Regulation of actin cytoskeleton
biu05165  Human papillomavirus infection
biu05200  Pathways in cancer
biu05222  Small cell lung cancer
biu05410  Hypertrophic cardiomyopathy
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05414  Dilated cardiomyopathy
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109573568 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    109573568 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109573568 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109573568 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109573568 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109573568 (ITGA2B)
   04611 Platelet activation
    109573568 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109573568 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109573568 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109573568 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    109573568 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109573568 (ITGA2B)
   05414 Dilated cardiomyopathy
    109573568 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109573568 (ITGA2B)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109573568 (ITGA2B)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109573568 (ITGA2B)
Cell adhesion molecules [BR:biu04515]
 Integrins
  Integrin alpha subunits
   109573568 (ITGA2B)
CD molecules [BR:biu04090]
 Proteins
  109573568 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS
Other DBs
NCBI-GeneID: 109573568
NCBI-ProteinID: XP_019836375
UniProt: A0A6P5DG50
LinkDB
Position
19
AA seq 1007 aa
MARALCLLRALWLLEWVQLLLGPGAMPPTWALNLDSVQFTVYTGPNGSHFGFSLDFYKNS
NGSVYVVVGAPRTLGHSEEETGGVFLCPWKAEGGQCISLPFDLYDETRSIGTQTFQTFKA
GQGLGASVVSWRDSIVACAPWQHWNVLDRNEEEAQKTPVGGCFVAQLQNGDRTEYSPCRD
NKMSQFYERNHFRDDRRYCEAGFSSVVTQAGELVLGAPGGYYFVGLLARAPIADIISSYR
PSTLLWHVPTQFTYDQSHLQYYDGYRGYSVAVGNFDGNPNTTEYVFGAPTWSWTLGAVEI
LDSYHQMLHRLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRAXRKLAEVGRVY
LFLQTRGARMLGAPNLLLTGTQLYGRFGSAIAPLGDLNRDGYNDVAVAAPCGGPNGQGQV
LVYLGQSEGLNPSPSQVLDSPFPTGSGFGFSLRGATDIDDNGYPDLLVGAYGASKVVVYR
AQPVVMVTVQLMVQDSLNPAVKTCVLSQTKTPVSCFNIQMCVGATGHNIPEKLHLNAELQ
LDRQKPRQGRRVLLLDSQQAGTILNLDLRGRHNPNCSTATAFLRDEADFRDKLSPIVLSF
SVSLPPEKDGGAPALVLHGNTHVQEQTRIILDCGDDDLCVPQLQLTASVKGSPLLIGADN
VLELQMDAANEGEGAYEAELTVYLPPGAHYMRAVSNMEGFERLICNQKKENETKVVLCEL
GNPMKSNAQIEVMMWVSVEKLEEAGEQVSFLLQIRSKNSQNPNSEMVELDVPVRAVAHVE
LRGNSFPASLVVAAEEGNGQNSSDSWGPKVEHTYELHNNGPGAVSGLRLNLYLPSQSQPS
DLLYILDIHPQGGLQCASQPSPNPLQLEWRLPTPSPSPAHHKRDRRQAVLPEEKQPSRLQ
DPILVSCDSAPCTVVQCELQEMARGQRVMVTVLALLSRSILQERPLDQFVLQSHAWFNVS
SFPYSVPALSLPSGEALVGVEWWWQKGSRGSPIGLPLSPCPAGTAWI
NT seq 3024 nt   +upstreamnt  +downstreamnt
atggccagagctctttgtctacttcgtgccctctggcttctggagtgggtgcagctgctt
ttgggacccggtgctatgcctccaacctgggccttgaacctggattcagtgcagttcact
gtctacacaggccctaatggcagccactttgggttttcactggacttctacaagaacagc
aatgggagtgtgtacgtcgtggtgggcgccccacggaccctgggccacagcgaggaggag
accggcggcgttttcctgtgcccctggaaggccgagggcggccagtgcatctcgctgccc
ttcgacctctatgatgaaacacgaagcataggcacccaaactttccaaaccttcaaggcc
gggcaaggactcggggcgtcggtcgttagttggagagacagcattgtggcctgcgccccc
tggcagcactggaacgtcctagataggaacgaggaggaggctcagaagacgcccgtaggt
ggctgcttcgtggctcagctccaaaacggcgaccgcacagagtactcgccctgccgggac
aacaaaatgagccagttttacgagagaaatcatttcagagacgacaggcgttactgcgaa
gccggcttcagctcggtagtcactcaggctggggagctggtgcttggggctcctggcggg
tactatttcgtaggtctcctggcgcgggctccaatcgccgatatcatctcaagttaccgc
ccaagcacccttttgtggcacgtgcccacccagttcacctacgaccagagtcacttacaa
tactacgacggctaccgggggtactccgtggccgtgggcaacttcgacggaaatcccaac
actacagagtatgtmttcggtgcccccacctggagttggaccctgggagcggtggaaatt
ttggactcgtaccaccagatgctgcaccggctgcatggagagcagatggcttcatatttt
gggcactcagtggccgtcactgacgtcaatggggatgggaggcatgacctcttggtgggt
gcaccactgtacatggagagccgtgctgrccgcaagctggccgaggtggggcgtgtgtac
ttgttcctgcagactcgaggcgcccgaatgctgggggcccccaacctactgctgactggc
acacagctctatgggcgatttggctcagccattgcacctctgggagacctcaatcgggat
ggctacaacgatgtcgcagtagccgccccctgtgggggtcccaacggtcaaggccaagtg
ttggtgtacctgggtcagagtgaggggcttaacccgtccccctcccaggtcctagacagc
cccttccccacaggctctggctttggtttctcccttcgaggtgccacagatatcgatgac
aacggatacccagacctgcttgtgggagcttacggggccagcaaggtcgtggtatacagg
gctcagccggtggtgatggtcactgtccagctgatggtgcaagattcactgaaccctgct
gtgaagacttgtgtcctgtcccagaccaagaccccagtgagctgctttaacatccagatg
tgtgtgggagccactgggcacaacattcccgagaagctgcacctgaatgccgagctgcag
ctggaccggcagaagccccgccagggccggcgggtcctactgctggactctcagcaggca
ggcaccatcctgaacctggatctgagaggcagacacaaccccaactgctccaccgccacg
gccttccttcgagatgaggccgacttccgggacaagctaagccctatcgtgctcagcttt
agtgtgtccctgccgccggagaaggatggaggagcccctgctctcgtgctgcayggaaac
acccacgtccaggaacagacccgcatcattctggactgtggggacgatgacctgtgtgtg
ccgcagctgcagctcactgctagcgtgaagggctccccactcctaattggagccgacaac
gtgctggagctgcaaatggatgcggccaatgagggtgagggagcctacgaggctgagctg
actgtgtacctgcccccaggcgcccactacatgcgggctgtcagcaacatggaggggttt
gagagactcatctgtaaccagaagaaggagaacgagaccaaggtggtgctgtgtgagctg
ggcaaccccatgaagagtaacgcccagatagaagtcatgatgtgggtgagcgtggagaag
ctggaagaggctggggagcaggtgtccttcctgctgcagatcaggagcaagaacagccag
aatccaaatagtgagatggtggagctggatgtgccagtccgggcagtggcccacgtggag
ttgagagggaattcctttccagcctccctggtggtggctgcagaagaagggaatgggcag
aacagctctgacagctggggccccaaagtggagcacacctacgagctccacaacaatggc
cctggtgctgtaagtggtctccgcctcaacctctacctccccagccagtcccagccctca
gacctgctctacatcctggatattcatccacagggaggccttcagtgcgcctcacagccc
tctcccaaccccctccagctggaatggaggctgcccacccccagcccttccccagcccat
cacaagcgggatcgcagacaggcggtcctgccggaggagaagcagccctcaaggctccaa
gatccaatcttggtgagctgcgactcggcgccctgtactgtggtgcagtgtgagctgcag
gagatggcacgcgggcagcgggtcatggtcacggtgctggccttgctgtcaaggtccatc
ctccaagagaggcccctggatcagtttgtgctgcagtcgcacgcttggttcaacgtctcc
tcctttccctactccgtgcctgccctcagcctgcccagcggggaagctctggtgggtgtg
gaatggtggtggcagaaagggtcccgcgggtctcccattggtcttcccctgagtccctgc
ccagccgggactgcctggatctga

DBGET integrated database retrieval system