KEGG   Bifidobacterium longum NCC2705: BL1559Help
Entry
BL1559            CDS       T00094                                 

Definition
(RefSeq) cystathionine gamma lyase
  KO
K01758  cystathionine gamma-lyase [EC:4.4.1.1]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
blo00260  Glycine, serine and threonine metabolism
blo00270  Cysteine and methionine metabolism
blo00450  Selenocompound metabolism
blo01100  Metabolic pathways
blo01110  Biosynthesis of secondary metabolites
blo01130  Biosynthesis of antibiotics
blo01230  Biosynthesis of amino acids
Module
blo_M00338  Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:blo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BL1559
   00270 Cysteine and methionine metabolism
    BL1559
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BL1559
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:blo04147]
    BL1559
Enzymes [BR:blo01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     BL1559
Exosome [BR:blo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BL1559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Met_gamma_lyase Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 1021731
NCBI-ProteinID: NP_696714
UniProt: Q8G436
LinkDB All DBs
Position
complement(1969854..1971377)
Genome map
AA seq 507 aa AA seqDB search
MFDLNRQLGYITTDFPGMQIGPLREPCFTAEFCGFIGVSHSVFSGPASALQTAPTKAAPR
TSPNHFFLYGALEPCNGAVFERCRLFARHGACWHAGRMASDLVHHGQSFDDQPLGFGTLA
IHLGNGVDAETGAIRRPITLANAYALPYDPSDINWSSSDVNLYTRNGHPNQRYLEEKLAR
LEGAEDAVVLASGVAALAATFTTFLNRGDHAIFSDTTYIAAYRLLNQILPEKYGIETSIL
DTSDPENVRAALRPNTKLVHIETPANPTLKVSDIATIAKLAHEANPDILVSVDNTFNTPY
NVRPLNLGADIVIESLTKYINGHGDALGGSIATTKARTDQIRFTAQVNFGGIISPFNAWL
INRGSVTLPLRIRQHNALALAIAKHLESLDVVRFVAYPGLESHPHHEVAVSQLARPDSGF
GGVLSFGLDTNHDGHNRFVSKLNVITSAVSLGHDESLIVFLGEDDERQYLYPPEFHRGFF
RLAVGLEDTDDLIRDIDHALVEAGFEV
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgacctcaacaggcaacttggctatataaccacagattttccaggtatgcaaatc
ggccccctacgcgaaccttgttttaccgcggaattctgcggttttatcggcgtgtctcac
agcgtgttttcagggcccgcttcggccctgcaaacagccccgaccaaggctgcaccccgc
acttcacccaatcattttttcttatatggtgctctagaaccttgcaatggcgcggttttc
gagcgatgtcgcctgtttgcgcggcacggcgcatgctggcatgctgggcgcatggcttct
gatcttgtacatcacggacaatcattcgacgaccagccgctcggattcggcacgctggcc
attcacctcggtaacggggtcgacgccgaaaccggcgcgatccgtcgccccatcacgctg
gcgaacgcctacgcgctgccctacgacccctcggacatcaactggtccagttcggacgtg
aacctctacacgcgcaacgggcatccgaaccagcgctatctggaagaaaagctggcccgt
cttgaaggtgccgaggatgcggtggtgctcgcttccggcgtggccgcgctggccgccacg
ttcaccacgttcctcaaccgaggcgaccacgcgatcttctccgacaccacctatatcgcc
gcctaccgcctgttgaaccagattctgccggagaagtacggcatcgaaacctccatcctg
gatacctccgatcccgagaacgtacgcgcggcgcttcgccccaacaccaagctggtgcat
atcgagacaccggcgaacccgacgctcaaggtctcggacatcgccaccatcgccaaactg
gcccacgaagcgaacccggacattctggtttcggtggacaacaccttcaacacgccgtac
aacgtgcgcccgctcaatctcggcgcggatatcgtcatcgaatcgctcaccaaatacatc
aacggccatggcgacgcgctgggcggctcgatcgccaccaccaaggcgcgcacggaccag
atccgcttcaccgcgcaggtgaacttcggcggcatcatctcgccgttcaatgcctggctg
atcaatcgcggctcggtgacgctgccactgcgcatccgccagcacaacgccttggccttg
gcgattgccaagcatctcgaatcgctggatgtggtgcgtttcgtggcgtaccccggtctg
gaatcgcacccgcaccacgaggtggcggtcagccagctggcccgcccggactccgggttc
ggcggcgtgctgtcgttcggcctcgacaccaatcatgacgggcacaaccggttcgtttcc
aagctcaatgtgattacgtcggccgtctcgctcggccatgacgaatcgctgatcgtgttc
ctcggcgaggatgacgagcgccagtacctgtacccgcctgagttccaccgcggcttcttc
cgtctggccgtgggtctggaggatacggacgatttgattcgcgacatcgatcacgcgctg
gtggaggccggattcgaggtgtga

DBGET integrated database retrieval system