KEGG   Burkholderia mallei 2002734299: BM45_1341Help
Entry
BM45_1341         CDS       T03872                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bmab  Burkholderia mallei 2002734299
Pathway
bmab00473  D-Alanine metabolism
bmab01100  Metabolic pathways
bmab01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmab00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BM45_1341 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BM45_1341 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmab01011]
    BM45_1341 (alr)
Enzymes [BR:bmab01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BM45_1341 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bmab01011]
 Precursor biosynthesis
  Racemase
   BM45_1341 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AJX02495
UniProt: A0A290Y9R3
LinkDB All DBs
Position
1:1462659..1463729
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLSVVRRHAAQSKVWAIVKANAYGHGLARVFPGLRGTDGFGLLD
LDEAVKLRELGWAGPILLLEGFFRSTDIDVIDRYSLTTAVHNDEQMRMLETARLSKPVNV
QLKMNSGMNRLGYTPEKYRAAWERARACPGIGQITLMTHFSDADGERGVAEQMATFERGA
QGIAGARSFANSAAVLWHPSAHFDWVRPGIMLYGASPSGRAADIADRGLKPTMTLASELI
AVQTLAKGQAVGYGSMFVAEDTMRIGVVACGYADGYPRIAPEGTPVVVDGVRTRIVGRVS
MDMLTVDLTPVPQAGVGARVELWGETLPIDDVAARCMTVGYELMCAVAPRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatttccgccacgatccacaccgcagctctcgcgaacaacctctccgtc
gtgcgccgccacgccgcccagtcgaaggtctgggcgatcgtcaaggcgaacgcgtacggg
cacggtctcgcgcgcgtctttcccgggctgcgcggcaccgacggcttcggcctgctcgac
ctcgacgaggccgtgaagctgcgcgaactgggctgggcggggccgatcctgctgctcgag
ggcttcttccggtcgaccgacatcgacgtgatcgaccgctacagcctgacgaccgcggtg
cacaacgacgagcagatgcgcatgctcgagaccgcgcggctgtcgaagcccgtgaacgtc
cagctgaagatgaacagcggcatgaaccggctcggctacacgcccgagaagtaccgggcc
gcctgggagcgcgcgcgcgcatgcccgggcatcggccagatcacgttgatgacccatttt
tcggacgccgacggcgaacgcggcgtggccgagcagatggcgacgttcgagcgcggcgcg
caaggcatcgccggcgcgcgcagcttcgcgaactcggccgccgtgctctggcacccgtcg
gcgcacttcgactgggtgcggcccggcatcatgctgtacggcgcgtcgccgtccggccgt
gcggcggacatcgccgaccggggcctgaagccgacgatgacgctcgcctccgagctgatc
gccgtgcagacgctcgcgaaagggcaggcggtcggctacggatcgatgttcgtcgccgag
gacacgatgcgcatcggcgtcgtcgcgtgcggctatgcggacggctatccgcggatcgcg
cccgagggcacgcccgtcgtcgtcgacggcgtgcgcacgcggatcgtcggccgcgtgtcg
atggacatgctgaccgtcgatctcacgcccgtgccgcaggcgggcgtcggcgcgcgcgtc
gagctgtggggcgagacgctgccgatcgacgacgtcgccgcgcgttgcatgacggtcggc
tacgagctgatgtgcgcggtcgcgccgcgcgtgcccgtgcgtgccgagtaa

DBGET integrated database retrieval system