KEGG   Burkholderia mallei 2000031063: DM57_401Help
Entry
DM57_401          CDS       T03522                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bmai  Burkholderia mallei 2000031063
Pathway
bmai00473  D-Alanine metabolism
bmai01100  Metabolic pathways
bmai01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DM57_401
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    DM57_401
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmai01011]
    DM57_401
Enzymes [BR:bmai01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     DM57_401
Peptidoglycan biosynthesis and degradation proteins [BR:bmai01011]
 Precursor biosynthesis
  Racemase
   DM57_401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIO82128
UniProt: A0A381BEF6
LinkDB All DBs
Position
1:3056946..3058016
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLSVVRRHAAQSKVWAIVKANAYGHGLARVFPGLRGTDGFGLLD
LDEAVKLRELGWAGPILLLEGFFRSTDIDVIDRYSLTTAVHNDEQMRMLETARLSKPVNV
QLKMNSGMNRLGYTPEKYRAAWERARACPGIGQITLMTHFSDADGERGVAEQMATFERGA
QGIAGARSFANSAAVLWHPSAHFDWVRPGIMLYGASPSGRAADIADRGLKPTMTLASELI
AVQTLAKGQAVGYGSMFVAEDTMRIGVVACGYADGYPRIAPEGTPVVVDGVRTRIVGRVS
MDMLTVDLTPVPQAGVGARVELWGETLPIDDVAARCMTVGYELMCAVAPRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatttccgccacgatccacaccgcagctctcgcgaacaacctctccgtc
gtgcgccgccacgccgcccagtcgaaggtctgggcgatcgtcaaggcgaacgcgtacggg
cacggtctcgcgcgcgtctttcccgggctgcgcggcaccgacggcttcggcctgctcgac
ctcgacgaggccgtgaagctgcgcgaactgggctgggcggggccgatcctgctgctcgag
ggcttcttccggtcgaccgacatcgacgtgatcgaccgctacagcctgacgaccgcggtg
cacaacgacgagcagatgcgcatgctcgagaccgcgcggctgtcgaagcccgtgaacgtc
cagctgaagatgaacagcggcatgaaccggctcggctacacgcccgagaagtaccgggcc
gcctgggagcgcgcgcgcgcatgcccgggcatcggccagatcacgttgatgacccatttt
tcggacgccgacggcgaacgcggcgtggccgagcagatggcgacgttcgagcgcggcgcg
caaggcatcgccggcgcgcgcagcttcgcgaactcggccgccgtgctctggcacccgtcg
gcgcacttcgactgggtgcggcccggcatcatgctgtacggcgcgtcgccgtccggccgt
gcggcggacatcgccgaccggggcctgaagccgacgatgacgctcgcctccgagctgatc
gccgtgcagacgctcgcgaaagggcaggcggtcggctacggatcgatgttcgtcgccgag
gacacgatgcgcatcggcgtcgtcgcgtgcggctatgcggacggctatccgcggatcgcg
cccgagggcacgcccgtcgtcgtcgacggcgtgcgcacgcggatcgtcggccgcgtgtcg
atggacatgctgaccgtcgatctcacgcccgtgccgcaggcgggcgtcggcgcgcgcgtc
gagctgtggggcgagacgctgccgatcgacgacgtcgccgcgcgttgcatgacggtcggc
tacgagctgatgtgcgcggtcgcgccgcgcgtgcccgtgcgtgccgagtaa

DBGET integrated database retrieval system