KEGG   Bermanella marisrubri: HF888_16430
Entry
HF888_16430       CDS       T06527                                 

Definition
(GenBank) hypothetical protein
Organism
bmar  Bermanella marisrubri
SSDB
Other DBs
NCBI-ProteinID: QIZ85927
LinkDB
Position
pBma45:32587..32808
AA seq 73 aa
MSNSDQFDGALKLGRWYRVVEEYQPDGSIELLVHDTRTGDVYSIEVPDLESYNKLVSLLS
DGSITRLKKVMGL
NT seq 222 nt   +upstreamnt  +downstreamnt
atgagtaattcagatcaatttgatggagcacttaaattagggcgttggtatcgagtggtt
gaagagtatcaaccagacggttcaattgaacttttagtgcatgatacgcgaactggtgat
gtttattctatcgaggttcctgatctcgaaagctataataagcttgttagtttgctatca
gatggttctataactcgattaaaaaaagttatgggcctatag

DBGET integrated database retrieval system