KEGG   Bacillus megaterium DSM 319: BMD_0789
Entry
BMD_0789          CDS       T01219                                 

Gene name
alsD
Definition
(GenBank) alpha-acetolactate decarboxylase
  KO
K01575  acetolactate decarboxylase [EC:4.1.1.5]
Organism
bmd  Bacillus megaterium DSM 319
Pathway
bmd00650  Butanoate metabolism
bmd00660  C5-Branched dibasic acid metabolism
Brite
KEGG Orthology (KO) [BR:bmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BMD_0789 (alsD)
   00660 C5-Branched dibasic acid metabolism
    BMD_0789 (alsD)
Enzymes [BR:bmd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.5  acetolactate decarboxylase
     BMD_0789 (alsD)
SSDB
Motif
Pfam: AAL_decarboxy
Other DBs
NCBI-ProteinID: ADF37651
UniProt: D5DB00
LinkDB
Position
complement(763752..764465)
AA seq 237 aa
MSNKEKLTIHQTSTMIALLDGVFDGVVTYKDLAKKGDFGIGTFNQLDGEMIAFDGEFYHI
TDGKAAPIGEDAKTPFAIMTTFYEDISYRVEKEMNREQLETLMNELIPSPNLFYAVRIDG
KFKEVKTRTVAKQEKPYPSMVDAAADQPTFTSSDVNGTLAGFYTPEYSSGIGVPGYHLHF
IDEYKKEGGHVLDVSVQDVTIQICKKTKLNLNLSETSEFLNANLEDHDVEEEIATAE
NT seq 714 nt   +upstreamnt  +downstreamnt
atgagcaataaagaaaaattaacgattcaccaaacttccaccatgatcgctttattagac
ggagtatttgacggtgttgtcacatacaaggatttagctaagaaaggtgatttcggcatc
ggtacgtttaatcaattggacggtgaaatgattgcctttgacggagaattttatcatatt
actgatgggaaagccgcgcctattggcgaagatgcaaaaacaccttttgccattatgaca
accttttatgaagatatctcttaccgtgtagaaaaggaaatgaatcgtgaacaactagaa
accttaatgaacgagcttattcctagcccgaatttattctatgcagttcgcattgacggg
aagtttaaagaagtaaaaacgcgcacggttgcaaagcaagagaagccctatccttctatg
gtagatgcggctgctgatcagcctacatttacatcttcagatgtaaatggaacactagca
ggtttttatacgccagaatattcttcaggcatcggtgttcccggctaccacctgcacttt
attgatgaatataaaaaagaagggggacatgttttagatgtctctgttcaggatgttaca
attcaaatctgcaaaaaaacgaaattaaatctcaatttatcggaaacaagtgaattttta
aatgctaatttagaagaccatgatgtagaagaagaaattgcgacggctgaataa

DBGET integrated database retrieval system