Brucella melitensis bv. 1 16M: BMEII0850 Help Entry BMEII0850         CDS       T00072                                  Name (GenBank) gdp-fucose synthetase   KO K02377   GDP-L-fucose synthase [EC:1.1.1.271] Organism bme  Brucella melitensis bv. 1 16M Pathway bme00051   Fructose and mannose metabolism bme00520   Amino sugar and nucleotide sugar metabolism bme00541   O-Antigen nucleotide sugar biosynthesis bme01100   Metabolic pathways bme01250   Biosynthesis of nucleotide sugars Brite KEGG Orthology (KO) [BR:bme00001]  09100 Metabolism   09101 Carbohydrate metabolism    00051 Fructose and mannose metabolism     BMEII0850    00520 Amino sugar and nucleotide sugar metabolism     BMEII0850   09107 Glycan biosynthesis and metabolism    00541 O-Antigen nucleotide sugar biosynthesis     BMEII0850 Enzymes [BR:bme01000]  1. Oxidoreductases   1.1  Acting on the CH-OH group of donors    1.1.1  With NAD+ or NADP+ as acceptor     1.1.1.271  GDP-L-fucose synthase      BMEII0850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Epimerase GDP_Man_Dehyd Motif Other DBs NCBI-ProteinID:  AAL54092 UniProt:  Q8YBP7 LinkDB All DBs Position II:885773..886117 Genome browser AA seq 114 aa AA seqDB search MLWGSGKPLREFLHVDDLADACLHLLRFYNGIEPVNIGSGEEISIKELALTVARIVGYEG RFEHDLSKPDGTPRKLLDTSRIEALGWQPRIRLEDGLRDVYRNWLEETAGSVAA NT seq 345 nt NT seq  +upstreamnt  +downstreamnt gtgctttggggcagcggcaagcccttgcgggaattcctgcatgtggacgacctcgccgat gcgtgcctgcatctcctgcgcttttataatggcatcgagccggtgaatatcggcagcgga gaagaaatctcgatcaaggaactggcactcaccgttgcacgtatcgttggctatgaaggc cgcttcgagcacgacctgagtaaaccggacggcacgccgcgcaagctgctcgatacatcg cgcatagaggcgcttggctggcagccgcgcatccgtctcgaagacggcttgcgcgatgtc tatcgaaactggctggaagaaaccgcaggctccgtcgccgcttaa

DBGET integrated database retrieval system