KEGG   Bombyx mori (domestic silkworm): 101747135Help
Entry
101747135         CDS       T02817                                 

Definition
(RefSeq) 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
bmor  Bombyx mori (domestic silkworm)
Pathway
bmor00061  Fatty acid biosynthesis
bmor00780  Biotin metabolism
bmor01100  Metabolic pathways
bmor01212  Fatty acid metabolism
Module
bmor_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bmor00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101747135
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    101747135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bmor01004]
    101747135
Enzymes [BR:bmor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     101747135
Lipid biosynthesis proteins [BR:bmor01004]
 Fatty acid synthase
  Component type
   101747135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-GeneID: 101747135
NCBI-ProteinID: XP_004930405
UniProt: H9JB39
LinkDB All DBs
Position
Un
AA seq 435 aa AA seqDB search
MRKYNTYLNLIRSINTINAVRRRVVVTGLGVVSPLGTGSELVWTNILKGKCGIVALNDEE
YINLPCRLAGLIPREKDGIVEKALSKSTLKSMAPATSLALVATSEALKDANWTPKSEHCK
EMTGVAIGMGMIDLNDVCITNEALKVGYNKVSPFFVPRILPNMAAGHISIKYGFRGPNHS
VSTACATGAHSIGDAFRFIKNGDADVMVCGGAEACISPLAIAGFCRLRALSTSFNGEPHK
ASRPFDKKRDGFVMGEGAAILILEEYEHAFKRSAKMYAEILGYGLSGDASHITTPREDGS
GAMLSMARALKDGNLQKEDITYINAHATSTPIGDGIESTAIKSLFKEHALKISVSSTKGA
HGHLLGAAGNLEAMFTILSCYHGVLPPTLNLDDPVDDLCYVAKNAKKWDHEKRIALKNSF
GFGGTNASLCIANIL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaatacaacacatatttaaatttaatccgaagtattaatactatcaatgccgtt
agacgtagggtagtcgttactggactgggtgtcgtatctcctttgggtactggatctgaa
ttagtatggacaaacatattgaagggaaaatgtggtatagtggctctcaatgatgaagaa
tacataaaccttccttgcagattagctgggcttatacctagagaaaaagatggtattgtt
gaaaaagcattgtcaaaatctactctgaagtcaatggctccagctacatcattagcattg
gttgctacatccgaggcacttaaagatgctaattggacgcctaaaagtgaacactgtaaa
gaaatgaccggtgttgcaataggcatgggtatgatagatttaaatgatgtctgtatcaca
aatgaagcattaaaagttggctacaacaaagtgagcccattctttgttcctagaatatta
ccaaatatggctgcagggcacataagtattaaatatggattcaggggacctaaccattct
gtttcgacagcttgtgcaactggtgctcattctataggggatgctttcaggtttataaaa
aatggtgatgctgatgttatggtatgtggtggtgcagaggcgtgtatcagccctttagct
atcgcaggtttctgtagactaagagcactgagtacttcattcaatggagaacctcataaa
gcttctaggccatttgataaaaaaagagatggttttgttatgggtgaaggagcagccata
ttgattttagaagaatatgaacatgctttcaaaaggagtgctaaaatgtatgctgaaatt
ttaggatatggtctttctggtgatgcttctcacataactacaccaagagaagatggaagt
ggagctatgttgtctatggcgagagccttgaaagatggcaatttgcaaaaagaagatata
acatatataaatgcccatgcaacatcaaccccgataggcgatggtattgaatcaacagct
attaagtcattattcaaggaacatgcattaaaaatatcagtttcttcaactaaaggagcc
catggacacttattaggtgctgctggaaatttagaagcaatgttcacaatattatcatgt
tatcatggtgtcctgccaccaactttgaaccttgacgaccctgtagacgacttgtgttat
gttgctaagaatgcgaaaaagtgggatcatgaaaagagaattgcattgaaaaactctttt
gggtttggtggtactaatgcatctctttgtattgctaatattttataa

DBGET integrated database retrieval system