Bacillus velezensis JS25R: NG74_03902 Help Entry NG74_03902        CDS       T03423                                  Symbol sdpR Name (GenBank) Transcriptional repressor SdpR   KO K26993   ArsR family transcriptional regulator, repressor of sdpIR and other operons Organism bmp  Bacillus velezensis JS25R Brite KEGG Orthology (KO) [BR:bmp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bmp03000]     NG74_03902 (sdpR) Transcription factors [BR:bmp03000]  Prokaryotic type   Helix-turn-helix    ArsR family     NG74_03902 (sdpR) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HTH_5 HTH_20 MarR_2 HTH_24 TrmB HTH_11 HTH_IclR MarR Sigma70_r4 HTH_38 HTH_23 HTH_Crp_2 UPF0122 HTH_28 ArsR Rrf2 PuR_N EutK_C Sigma70_r4_2 Radical_SAM_C HTH_DeoR HTH_10 Fe_dep_repress HTH_37 DprA_WH DUF4423 HTH_40 Dimerisation2 Motif Other DBs NCBI-ProteinID:  AIU83903 UniProt:  A0A1D9PQC4 LinkDB All DBs Position complement(3919562..3919849) Genome browser AA seq 95 aa AA seqDB search MNKAFKALADPTRRRILDLLKKQDMTAGEIAEHFDMSKPSISHHLTILKNTDLVHDERKG QFIMYSLNTTVLQDLIGWFFSLTDSEHDNKKGGES NT seq 288 nt NT seq  +upstreamnt  +downstreamnt ttgaataaagcttttaaagcactggccgatcctacaaggagaagaattttggacttatta aagaaacaagacatgacagctggtgaaattgcggaacacttcgacatgtcaaaacccagt atttctcatcaccttaccatattgaaaaatactgatttggttcacgatgagaggaaaggc caatttattatgtattcattaaataccactgtattacaggatcttataggctggttcttt tctctgactgattcagaacatgataataagaaaggcggggaatcatga

DBGET integrated database retrieval system