Brucella suis ATCC 23445: BSUIS_A0485 Help Entry BSUIS_A0485       CDS       T00638                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bmt  Brucella suis ATCC 23445 Pathway bmt01100   Metabolic pathways bmt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BSUIS_A0485 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BSUIS_A0485 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ABY37573 UniProt:  B0CKE3 LinkDB All DBs Position I:476152..476388 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgcagagcgcgtcaagaaaatcgttgttgaacatctgggcgtagatgcc gacaaggtcacggaaggcgcaagtttcattgatgacctcggcgcagacagcctcgacacc gtcgagctggtcatggcctttgaagaagaattcggcgttgaaattcctgacgacgctgcc gaaacgatccttacggtcggtgatgctgtgaagttcatcgataaggcttctgcctga

DBGET integrated database retrieval system