KEGG   Burkholderia multivorans ATCC BAA-247: NP80_974
Entry
NP80_974          CDS       T03881                                 

Definition
(GenBank) hypothetical protein
Organism
bmul  Burkholderia multivorans ATCC BAA-247
SSDB
Motif
Pfam: Glutaredoxin
Other DBs
NCBI-ProteinID: AJY18948
LinkDB
Position
1:1038505..1039227
AA seq 240 aa
MKPAAIGLAAILTVVAGAASAQSAPVASSRTVPAQVQNSIDAMLDERLARDWGLRLEEWA
RYRQLMQGPLGVYSPNLDPLTALGIEARSDEERNRYAELHVQAESKRVGKTLAYQRAYDA
AWKRLYPGQQRVDMPGAKAPGAGNRGSGRLAVFVKAECPPCEQRARQLQAAGTAFDLYMV
GSRQDDARIRQWATQAGIDAGRVRARTITLNHDAGRWLSLGLPGDLPAVVREVNGQWQRQ
NT seq 723 nt   +upstreamnt  +downstreamnt
atgaaaccagccgcgatcggtcttgccgccatcctcaccgtcgtcgcgggtgctgcctcg
gcgcagtcggcgccggttgcgtcctcgcgcacggttcccgcccaggttcagaacagcatc
gacgccatgctggacgagcgcctagcgcgcgattggggtctgcggctggaggaatgggcg
cgctaccggcaactgatgcaggggccgctgggcgtctattccccgaacctcgatccgctc
acggccctgggcatcgaggcgcgcagcgacgaggaacgcaaccgctatgcggagctgcat
gtgcaggcggaatcgaagcgcgtgggcaagacgctggcctaccagcgggcctacgacgcc
gcctggaagcggctctatccgggccagcagcgtgtggacatgccgggcgcgaaggcgccg
ggcgccggcaaccggggttcgggccggctggcggttttcgtgaaggccgagtgtccgccg
tgcgagcagcgcgcgcgccagttgcaggcggccggcacagccttcgatctctacatggtc
ggcagccgccaggacgatgcccgcatccgccagtgggcgacccaggccggcatcgacgcc
ggccgcgtgcgcgcgcgcaccatcacgctcaatcacgacgccgggcgctggctgtcgctc
ggcctgcccggcgatctgcccgccgtggtgcgcgaggtcaatggccaatggcagcggcag
tag

DBGET integrated database retrieval system