KEGG   Bacillus mycoides ATCC 6462: BG05_3912Help
Entry
BG05_3912         CDS       T03798                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bmyo  Bacillus mycoides ATCC 6462
Pathway
bmyo00473  D-Alanine metabolism
bmyo01100  Metabolic pathways
bmyo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bmyo00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BG05_3912 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BG05_3912 (alr)
Enzymes [BR:bmyo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BG05_3912 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bmyo01011]
 Precursor biosynthesis
  Racemase
   BG05_3912 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AJH22016
UniProt: A0A084J6Z2
LinkDB All DBs
Position
complement(3783535..3784710)
Genome map
AA seq 391 aa AA seqDB search
MSLKYGRDTIVEVDLNAVKHNVKEFKKRVNDENIAMMAAVKANGYGHGAVEVAKSAIEAG
INQLAVAFVDEAIELREAGITVPILILGYTPVAAVEDVIQYDVMMTVYRVEDLQGIDEVA
NHLQKKVRIHVKIDTGMSRIGLQEEEVKPFFEELKRMRYVEVVGMFTHYSTADEIDKTYT
NMQTSLFEKAVNTAEELGIHFPYIHSSNSAGSMELSNTFQNMVRVGIGIYGMYPSREVDH
TVASLQPALSLKSKVAHVKHAKKNRGVSYGNTYVTTGEEWIATVPIGYADGYNRQLSNKG
HALINGVRVPVIGRVCMDQLMLDVTNAMPVQVGDEVVFYGKQGEEEIAVEEIADMLGTIN
YEVTCMLDRRIPRVYKKNDETTAVVNILRKK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgaaatatggaagagatacaattgttgaagttgacttaaatgcggtaaaacat
aatgtaaaagaatttaaaaaacgtgtgaatgatgaaaatattgcaatgatggctgctgta
aaagcgaatgggtatggtcatggggcagttgaagttgcgaaatcggctattgaagcagga
ataaaccaacttgcagttgcatttgtagacgaagcaattgaattaagagaagctggaatc
actgtacctattttaattttaggatatacaccagtagcagctgtagaagatgtaattcaa
tatgacgttatgatgactgtttatagagtagaagatttacaaggtatagatgaagttgca
aaccatcttcaaaagaaagtgcgaattcatgtgaaaattgatacaggaatgagccgtatt
ggtttacaggaagaagaagttaaaccgttttttgaagagttaaaacgtatgcgatatgta
gaagtagtagggatgtttacacattactctaccgccgatgaaatagataaaacttataca
aatatgcaaacaagtttgtttgaaaaagctgtaaatacagcggaagaattaggaattcat
tttccatatattcatagttcaaacagtgcaggatcaatggaacttagtaacacatttcaa
aatatggttcgtgtcggtattggaatttacggtatgtatccttcaagagaagtggatcat
acagttgcttccttacagccagcgttgtctttaaaatcaaaagtagctcatgttaaacat
gcgaagaaaaatcgtggtgttagctatgggaatacttatgtaacaacgggcgaagaatgg
attgcaactgtaccgattggttatgctgatggttataatcgtcagctatctaataaaggg
catgcactaataaacggagtacgagtacctgtaattggccgtgtttgtatggatcagctt
atgctagatgttacaaatgcaatgccagtacaagtaggagacgaagttgtattctacggc
aaacaaggtgaagaagagattgcggtggaagaaatagcagatatgttaggtacaattaat
tatgaagttacatgcatgttggatagaagaattccacgtgtttataaaaaaaatgatgaa
acgactgcggttgtaaatatattaagaaaaaaataa

DBGET integrated database retrieval system