KEGG   Bombella sp. ESL0368: GN304_00605Help
Entry
GN304_00605       CDS       T06372                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bob  Bombella sp. ESL0368
Brite
KEGG Orthology (KO) [BR:bob00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GN304_00605 (ahpF)
Enzymes [BR:bob01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GN304_00605 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 Glutaredoxin HI0933_like FAD_oxidored Thi4 DAO FAD_binding_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: QGT74440
LinkDB All DBs
Position
132837..134402
Genome map
AA seq 521 aa AA seqDB search
MLNDELKGQLRGYLQHLRHNIILVASLDEGDKSREMKEFLNEISELSDKVSYQEGGNDVR
RPSFLIRAADSDVQVCFAGIPMGHEFTSLVLALLQVGGHPPKVEAEQVAQIKALKGDFHF
ETYFSLSCHNCPDVVQALNTLSVLNPNIRHTAIDGALFQDEVNERDVRSVPQVFLNGERF
STGRMELPEILAKIDTEGAAKASEKLNDEAPFDTLVIGSGPAGCAAAIYTARKGVRTGLL
AERFGGQVMDTAGIENFISVPETEGPALAKNLEQHVRSYDVRVITAQRAAKLIPAEKEGG
LHEIVLESGAHLKARTIIVATGARWRQLNVPGEEEYRTRGVAYCPHCDGPFFKGRPVAVA
GGGNSGVEAAIDLAGIVSHVTLLQYDPVLTADEVLQNKVRSLPNVDIVVNARTTEIRGDG
RKMTGLSWQDVKDGSEHSIDVDGIFVQIGLLPNTDWLKGGIEMSRIGEIGIDERCRTSIP
GVFAAGDATTVPYKQIIVAMGEGAKAALSAFDHIIRVPAAS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacgacgaactcaaaggccagctgagagggtacctccagcatctgcgccacaac
atcattcttgttgcctcccttgatgagggcgataagtcccgtgagatgaaagaatttctt
aacgaaatttccgaactctctgataaggtttcctatcaggaaggtggcaatgacgtccgt
cgcccgtctttcctgatccgtgccgcagattcagatgttcaggtctgctttgcgggcatc
ccgatgggccacgagtttacgtctctggtactggccctgcttcaggttggtggtcacccg
ccgaaggtcgaggctgaacaggttgcgcagatcaaggccctgaagggtgatttccatttc
gagacctatttctccctgtcctgccacaactgcccggatgtcgttcaggccctgaacacg
ctgagcgtgctcaaccccaacatccgccacacggccattgatggtgccctgttccaggat
gaggtgaacgagcgtgatgtgcgttccgtccctcaggtgttcctgaacggtgagcgtttc
tccaccggtcgcatggaactgccggagattctggccaagatcgatactgaaggtgctgcc
aaggcttccgagaagctgaatgacgaggctccgttcgacacgctggtgatcgggtccggt
ccggctggctgtgccgccgccatctacacggcccgcaagggtgtccgcactggtctgctg
gctgagcgcttcggtggtcaggtcatggatacggctggcatcgagaacttcatctccgta
ccggagaccgaaggtccggcccttgccaagaatctggagcagcatgttcgcagctatgat
gtccgtgtcatcacggcacagcgtgctgccaagctgatcccggccgagaaggaaggtggc
ctgcacgagatcgtgctggagagcggtgcccacctgaaggcccgtaccatcatcgtggca
acaggtgcccgctggcgtcagctgaacgtgccgggtgaggaagaataccgcacacggggc
gtcgcctactgcccgcattgtgatggtccgttcttcaagggccgtccggttgctgttgcc
ggtggtggcaacagtggcgtggaagccgccatcgacctcgccggtatcgtgtcccacgtg
acgctgcttcagtatgaccctgtgctgacggctgatgaggtccttcagaacaaggtccgc
agcctgccgaatgtcgatatcgtggtgaacgcccgcacgaccgagatccgtggtgatggc
cgcaagatgaccggcctgagctggcaggatgtcaaggatggcagcgagcacagcatcgac
gtggacggcatctttgtccagatcggcctgctgccgaacacggattggttgaagggtggc
atcgagatgtcccgcatcggtgagatcggcattgacgagcgttgccgtacctccatcccc
ggcgtgtttgctgccggtgatgccacgacggtgccgtacaagcagatcatcgtggcgatg
ggtgagggtgccaaggctgccctgtctgcctttgaccacatcatccgtgtcccggctgct
tcctga

DBGET integrated database retrieval system