KEGG   Bos mutus (wild yak): 102265427
Entry
102265427         CDS       T02919                                 

Gene name
AKT3
Definition
(RefSeq) AKT serine/threonine kinase 3
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04010  MAPK signaling pathway
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04140  Autophagy - animal
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04210  Apoptosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04218  Cellular senescence
bom04261  Adrenergic signaling in cardiomyocytes
bom04370  VEGF signaling pathway
bom04371  Apelin signaling pathway
bom04380  Osteoclast differentiation
bom04510  Focal adhesion
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04611  Platelet activation
bom04613  Neutrophil extracellular trap formation
bom04620  Toll-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom04668  TNF signaling pathway
bom04722  Neurotrophin signaling pathway
bom04725  Cholinergic synapse
bom04728  Dopaminergic synapse
bom04910  Insulin signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04920  Adipocytokine signaling pathway
bom04922  Glucagon signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04926  Relaxin signaling pathway
bom04929  GnRH secretion
bom04931  Insulin resistance
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom04973  Carbohydrate digestion and absorption
bom05010  Alzheimer disease
bom05017  Spinocerebellar ataxia
bom05132  Salmonella infection
bom05135  Yersinia infection
bom05142  Chagas disease
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05205  Proteoglycans in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102265427 (AKT3)
   04012 ErbB signaling pathway
    102265427 (AKT3)
   04014 Ras signaling pathway
    102265427 (AKT3)
   04015 Rap1 signaling pathway
    102265427 (AKT3)
   04370 VEGF signaling pathway
    102265427 (AKT3)
   04371 Apelin signaling pathway
    102265427 (AKT3)
   04630 JAK-STAT signaling pathway
    102265427 (AKT3)
   04668 TNF signaling pathway
    102265427 (AKT3)
   04066 HIF-1 signaling pathway
    102265427 (AKT3)
   04068 FoxO signaling pathway
    102265427 (AKT3)
   04072 Phospholipase D signaling pathway
    102265427 (AKT3)
   04071 Sphingolipid signaling pathway
    102265427 (AKT3)
   04024 cAMP signaling pathway
    102265427 (AKT3)
   04022 cGMP-PKG signaling pathway
    102265427 (AKT3)
   04151 PI3K-Akt signaling pathway
    102265427 (AKT3)
   04152 AMPK signaling pathway
    102265427 (AKT3)
   04150 mTOR signaling pathway
    102265427 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102265427 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    102265427 (AKT3)
   04218 Cellular senescence
    102265427 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102265427 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102265427 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102265427 (AKT3)
   04613 Neutrophil extracellular trap formation
    102265427 (AKT3)
   04620 Toll-like receptor signaling pathway
    102265427 (AKT3)
   04625 C-type lectin receptor signaling pathway
    102265427 (AKT3)
   04660 T cell receptor signaling pathway
    102265427 (AKT3)
   04662 B cell receptor signaling pathway
    102265427 (AKT3)
   04664 Fc epsilon RI signaling pathway
    102265427 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    102265427 (AKT3)
   04062 Chemokine signaling pathway
    102265427 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102265427 (AKT3)
   04922 Glucagon signaling pathway
    102265427 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    102265427 (AKT3)
   04920 Adipocytokine signaling pathway
    102265427 (AKT3)
   04929 GnRH secretion
    102265427 (AKT3)
   04915 Estrogen signaling pathway
    102265427 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    102265427 (AKT3)
   04917 Prolactin signaling pathway
    102265427 (AKT3)
   04926 Relaxin signaling pathway
    102265427 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    102265427 (AKT3)
   04919 Thyroid hormone signaling pathway
    102265427 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102265427 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102265427 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    102265427 (AKT3)
   04728 Dopaminergic synapse
    102265427 (AKT3)
   04722 Neurotrophin signaling pathway
    102265427 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102265427 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    102265427 (AKT3)
   04213 Longevity regulating pathway - multiple species
    102265427 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102265427 (AKT3)
   05205 Proteoglycans in cancer
    102265427 (AKT3)
   05230 Central carbon metabolism in cancer
    102265427 (AKT3)
   05231 Choline metabolism in cancer
    102265427 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102265427 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102265427 (AKT3)
   05212 Pancreatic cancer
    102265427 (AKT3)
   05225 Hepatocellular carcinoma
    102265427 (AKT3)
   05226 Gastric cancer
    102265427 (AKT3)
   05214 Glioma
    102265427 (AKT3)
   05221 Acute myeloid leukemia
    102265427 (AKT3)
   05220 Chronic myeloid leukemia
    102265427 (AKT3)
   05218 Melanoma
    102265427 (AKT3)
   05211 Renal cell carcinoma
    102265427 (AKT3)
   05215 Prostate cancer
    102265427 (AKT3)
   05213 Endometrial cancer
    102265427 (AKT3)
   05224 Breast cancer
    102265427 (AKT3)
   05222 Small cell lung cancer
    102265427 (AKT3)
   05223 Non-small cell lung cancer
    102265427 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102265427 (AKT3)
   05017 Spinocerebellar ataxia
    102265427 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102265427 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102265427 (AKT3)
   04931 Insulin resistance
    102265427 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102265427 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102265427 (AKT3)
   05135 Yersinia infection
    102265427 (AKT3)
   05152 Tuberculosis
    102265427 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102265427 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    102265427 (AKT3)
   05161 Hepatitis B
    102265427 (AKT3)
   05160 Hepatitis C
    102265427 (AKT3)
   05164 Influenza A
    102265427 (AKT3)
   05162 Measles
    102265427 (AKT3)
   05168 Herpes simplex virus 1 infection
    102265427 (AKT3)
   05163 Human cytomegalovirus infection
    102265427 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102265427 (AKT3)
   05169 Epstein-Barr virus infection
    102265427 (AKT3)
   05165 Human papillomavirus infection
    102265427 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102265427 (AKT3)
   05142 Chagas disease
    102265427 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102265427 (AKT3)
   01524 Platinum drug resistance
    102265427 (AKT3)
   01522 Endocrine resistance
    102265427 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102265427 (AKT3)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102265427 (AKT3)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102265427 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 102265427
NCBI-ProteinID: XP_005897270
LinkDB
Position
Un
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaaccccaagatgtggatttaccttatcccctcaacaacttttcagtagcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccagtggacc
actgttatagagagaacatttcacgtagatactccagaggaaagggaagaatggacagaa
gctatccaggctgtagcagacagactccagaggcaagaagaagagagaatgaattgtagt
ccaacttcacaaattgataatataggagaggaagagatggatgcttctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtggaaaatattatgctatgaagattctgaag
aaagaagttattattgccaaggatgaagtggcgcacactttaactgaaagcagagtatta
aagaatactagacatccctttttaacatccctgaaatattccttccagacaaaagaccgt
ttatgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctccgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagatggccacataaaaatcacagattttggactttgcaaagaagggatcactgatgca
gccaccatgaagactttctgtggtacaccagagtatctggcaccagaggtgttagaagat
aatgactatggccgagctgtggattggtggggccttggggttgtcatgtatgaaatgatg
tgcgggagattacctttctataaccaggatcatgagaaactttttgaactaattctaatg
gaagatattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcaggcctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
agacacagtttcttttctggagtaaactggcaagatgtgtatgataaaaagcttgtacct
ccttttaagcctcaagtaacgtctgagacagacaccagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatatgatgaggacggtatggactgcatg
gacaatgagaggcggccgcacttccctcaattttcctactctgcaagtggacgagaataa

KEGG   Bos mutus (wild yak): 102275199
Entry
102275199         CDS       T02919                                 

Gene name
AKT2
Definition
(RefSeq) AKT serine/threonine kinase 2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04010  MAPK signaling pathway
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04140  Autophagy - animal
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04210  Apoptosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04218  Cellular senescence
bom04261  Adrenergic signaling in cardiomyocytes
bom04370  VEGF signaling pathway
bom04371  Apelin signaling pathway
bom04380  Osteoclast differentiation
bom04510  Focal adhesion
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04611  Platelet activation
bom04613  Neutrophil extracellular trap formation
bom04620  Toll-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom04668  TNF signaling pathway
bom04722  Neurotrophin signaling pathway
bom04725  Cholinergic synapse
bom04728  Dopaminergic synapse
bom04910  Insulin signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04920  Adipocytokine signaling pathway
bom04922  Glucagon signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04926  Relaxin signaling pathway
bom04929  GnRH secretion
bom04931  Insulin resistance
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom04973  Carbohydrate digestion and absorption
bom05010  Alzheimer disease
bom05017  Spinocerebellar ataxia
bom05132  Salmonella infection
bom05135  Yersinia infection
bom05142  Chagas disease
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05205  Proteoglycans in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102275199 (AKT2)
   04012 ErbB signaling pathway
    102275199 (AKT2)
   04014 Ras signaling pathway
    102275199 (AKT2)
   04015 Rap1 signaling pathway
    102275199 (AKT2)
   04370 VEGF signaling pathway
    102275199 (AKT2)
   04371 Apelin signaling pathway
    102275199 (AKT2)
   04630 JAK-STAT signaling pathway
    102275199 (AKT2)
   04668 TNF signaling pathway
    102275199 (AKT2)
   04066 HIF-1 signaling pathway
    102275199 (AKT2)
   04068 FoxO signaling pathway
    102275199 (AKT2)
   04072 Phospholipase D signaling pathway
    102275199 (AKT2)
   04071 Sphingolipid signaling pathway
    102275199 (AKT2)
   04024 cAMP signaling pathway
    102275199 (AKT2)
   04022 cGMP-PKG signaling pathway
    102275199 (AKT2)
   04151 PI3K-Akt signaling pathway
    102275199 (AKT2)
   04152 AMPK signaling pathway
    102275199 (AKT2)
   04150 mTOR signaling pathway
    102275199 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102275199 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    102275199 (AKT2)
   04218 Cellular senescence
    102275199 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102275199 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102275199 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102275199 (AKT2)
   04613 Neutrophil extracellular trap formation
    102275199 (AKT2)
   04620 Toll-like receptor signaling pathway
    102275199 (AKT2)
   04625 C-type lectin receptor signaling pathway
    102275199 (AKT2)
   04660 T cell receptor signaling pathway
    102275199 (AKT2)
   04662 B cell receptor signaling pathway
    102275199 (AKT2)
   04664 Fc epsilon RI signaling pathway
    102275199 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    102275199 (AKT2)
   04062 Chemokine signaling pathway
    102275199 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102275199 (AKT2)
   04922 Glucagon signaling pathway
    102275199 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    102275199 (AKT2)
   04920 Adipocytokine signaling pathway
    102275199 (AKT2)
   04929 GnRH secretion
    102275199 (AKT2)
   04915 Estrogen signaling pathway
    102275199 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    102275199 (AKT2)
   04917 Prolactin signaling pathway
    102275199 (AKT2)
   04926 Relaxin signaling pathway
    102275199 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    102275199 (AKT2)
   04919 Thyroid hormone signaling pathway
    102275199 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102275199 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102275199 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    102275199 (AKT2)
   04728 Dopaminergic synapse
    102275199 (AKT2)
   04722 Neurotrophin signaling pathway
    102275199 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102275199 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    102275199 (AKT2)
   04213 Longevity regulating pathway - multiple species
    102275199 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102275199 (AKT2)
   05205 Proteoglycans in cancer
    102275199 (AKT2)
   05230 Central carbon metabolism in cancer
    102275199 (AKT2)
   05231 Choline metabolism in cancer
    102275199 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102275199 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102275199 (AKT2)
   05212 Pancreatic cancer
    102275199 (AKT2)
   05225 Hepatocellular carcinoma
    102275199 (AKT2)
   05226 Gastric cancer
    102275199 (AKT2)
   05214 Glioma
    102275199 (AKT2)
   05221 Acute myeloid leukemia
    102275199 (AKT2)
   05220 Chronic myeloid leukemia
    102275199 (AKT2)
   05218 Melanoma
    102275199 (AKT2)
   05211 Renal cell carcinoma
    102275199 (AKT2)
   05215 Prostate cancer
    102275199 (AKT2)
   05213 Endometrial cancer
    102275199 (AKT2)
   05224 Breast cancer
    102275199 (AKT2)
   05222 Small cell lung cancer
    102275199 (AKT2)
   05223 Non-small cell lung cancer
    102275199 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102275199 (AKT2)
   05017 Spinocerebellar ataxia
    102275199 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102275199 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102275199 (AKT2)
   04931 Insulin resistance
    102275199 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102275199 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102275199 (AKT2)
   05135 Yersinia infection
    102275199 (AKT2)
   05152 Tuberculosis
    102275199 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102275199 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    102275199 (AKT2)
   05161 Hepatitis B
    102275199 (AKT2)
   05160 Hepatitis C
    102275199 (AKT2)
   05164 Influenza A
    102275199 (AKT2)
   05162 Measles
    102275199 (AKT2)
   05168 Herpes simplex virus 1 infection
    102275199 (AKT2)
   05163 Human cytomegalovirus infection
    102275199 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102275199 (AKT2)
   05169 Epstein-Barr virus infection
    102275199 (AKT2)
   05165 Human papillomavirus infection
    102275199 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102275199 (AKT2)
   05142 Chagas disease
    102275199 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102275199 (AKT2)
   01524 Platinum drug resistance
    102275199 (AKT2)
   01522 Endocrine resistance
    102275199 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102275199 (AKT2)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102275199 (AKT2)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102275199 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 102275199
NCBI-ProteinID: XP_005890648
LinkDB
Position
Un
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGDDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITVTPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccataagcgcggtgaatatatcaag
acctggcggccccggtacttcctgctgaagagcgacggctccttcattggctataaggag
cggcctgaggcccccgaccagaccctgccccccttaaacaacttctctgtcgcagaatgc
cagctgatgaagaccgagagacctcggcccaataccttcgtcattcgctgtctgcagtgg
accacagtcatcgagaggaccttccatgttgactccccagacgagagggaagagtggatg
cgggccatccagatggttgccaacagcctcaagcagaggggtccaggggacgaccccatg
gactacaagtgtggctcccccagcgactcttctgcggccgaggagatggaggtggcagtt
agcaaggcgcgggccaaggtgaccatgaatgacttcgactatctcaaactcctgggcaaa
ggcacctttggcaaggtcatcctggtgcgggagaaggccactggccgctactatgccatg
aagatcctgcggaaggaggtgatcatcgccaaggatgaagtcgcccacacggtcaccgag
agccgggtcctgcagaacaccaggcacccgttcctcaccgcgctgaagtacgccttccag
acacacgaccgcctgtgcttcgtgatggagtacgccaacggcggcgagctgttcttccac
ctgtcccgggagcgtgtcttcacagaggagcgggcccgcttctatggagcggagatcgtc
tcagccctggagtacctgcactcgcgggacgtggtgtaccgcgacatcaagctggaaaac
ctcatgctggacaaggacggccacatcaagatcaccgacttcggcctgtgcaaggagggc
atcagcgacggggccaccatgaagaccttttgtgggacccctgagtacctggcgcccgag
gtgctggaggacaacgactatggccgggcggtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggatcacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttcccgcgcacgctcagccctgaggccaagtccctg
cttgctgggctgcttaagaaggaccctaagcagaggctcggcggagggcccagtgacgcc
aaggaggtcatggagcacaggttcttccttagtatcaactggcaggacgtggtccagaag
aagctcctgccacccttcaagcctcaggtcacgtctgaggtcgacacaaggtactttgac
gacgagttcaccgcccagtccatcacagtcacgcccccggaccgctatgacagcctgggc
tcactggagctggaccagcggacgcacttcccccagttctcctattcggccagcatccga
gagtga

KEGG   Bos mutus (wild yak): 102283212
Entry
102283212         CDS       T02919                                 

Gene name
AKT1
Definition
(RefSeq) AKT serine/threonine kinase 1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04010  MAPK signaling pathway
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04022  cGMP-PKG signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04140  Autophagy - animal
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04210  Apoptosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04218  Cellular senescence
bom04261  Adrenergic signaling in cardiomyocytes
bom04370  VEGF signaling pathway
bom04371  Apelin signaling pathway
bom04380  Osteoclast differentiation
bom04510  Focal adhesion
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04611  Platelet activation
bom04613  Neutrophil extracellular trap formation
bom04620  Toll-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  JAK-STAT signaling pathway
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom04668  TNF signaling pathway
bom04722  Neurotrophin signaling pathway
bom04725  Cholinergic synapse
bom04728  Dopaminergic synapse
bom04910  Insulin signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04920  Adipocytokine signaling pathway
bom04922  Glucagon signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04926  Relaxin signaling pathway
bom04929  GnRH secretion
bom04931  Insulin resistance
bom04932  Non-alcoholic fatty liver disease
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom04973  Carbohydrate digestion and absorption
bom05010  Alzheimer disease
bom05017  Spinocerebellar ataxia
bom05132  Salmonella infection
bom05135  Yersinia infection
bom05142  Chagas disease
bom05145  Toxoplasmosis
bom05152  Tuberculosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  Human T-cell leukemia virus 1 infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05168  Herpes simplex virus 1 infection
bom05169  Epstein-Barr virus infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05205  Proteoglycans in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102283212 (AKT1)
   04012 ErbB signaling pathway
    102283212 (AKT1)
   04014 Ras signaling pathway
    102283212 (AKT1)
   04015 Rap1 signaling pathway
    102283212 (AKT1)
   04370 VEGF signaling pathway
    102283212 (AKT1)
   04371 Apelin signaling pathway
    102283212 (AKT1)
   04630 JAK-STAT signaling pathway
    102283212 (AKT1)
   04668 TNF signaling pathway
    102283212 (AKT1)
   04066 HIF-1 signaling pathway
    102283212 (AKT1)
   04068 FoxO signaling pathway
    102283212 (AKT1)
   04072 Phospholipase D signaling pathway
    102283212 (AKT1)
   04071 Sphingolipid signaling pathway
    102283212 (AKT1)
   04024 cAMP signaling pathway
    102283212 (AKT1)
   04022 cGMP-PKG signaling pathway
    102283212 (AKT1)
   04151 PI3K-Akt signaling pathway
    102283212 (AKT1)
   04152 AMPK signaling pathway
    102283212 (AKT1)
   04150 mTOR signaling pathway
    102283212 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102283212 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    102283212 (AKT1)
   04218 Cellular senescence
    102283212 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102283212 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102283212 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102283212 (AKT1)
   04613 Neutrophil extracellular trap formation
    102283212 (AKT1)
   04620 Toll-like receptor signaling pathway
    102283212 (AKT1)
   04625 C-type lectin receptor signaling pathway
    102283212 (AKT1)
   04660 T cell receptor signaling pathway
    102283212 (AKT1)
   04662 B cell receptor signaling pathway
    102283212 (AKT1)
   04664 Fc epsilon RI signaling pathway
    102283212 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    102283212 (AKT1)
   04062 Chemokine signaling pathway
    102283212 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102283212 (AKT1)
   04922 Glucagon signaling pathway
    102283212 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    102283212 (AKT1)
   04920 Adipocytokine signaling pathway
    102283212 (AKT1)
   04929 GnRH secretion
    102283212 (AKT1)
   04915 Estrogen signaling pathway
    102283212 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    102283212 (AKT1)
   04917 Prolactin signaling pathway
    102283212 (AKT1)
   04926 Relaxin signaling pathway
    102283212 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    102283212 (AKT1)
   04919 Thyroid hormone signaling pathway
    102283212 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102283212 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102283212 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    102283212 (AKT1)
   04728 Dopaminergic synapse
    102283212 (AKT1)
   04722 Neurotrophin signaling pathway
    102283212 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102283212 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    102283212 (AKT1)
   04213 Longevity regulating pathway - multiple species
    102283212 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102283212 (AKT1)
   05205 Proteoglycans in cancer
    102283212 (AKT1)
   05230 Central carbon metabolism in cancer
    102283212 (AKT1)
   05231 Choline metabolism in cancer
    102283212 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102283212 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102283212 (AKT1)
   05212 Pancreatic cancer
    102283212 (AKT1)
   05225 Hepatocellular carcinoma
    102283212 (AKT1)
   05226 Gastric cancer
    102283212 (AKT1)
   05214 Glioma
    102283212 (AKT1)
   05221 Acute myeloid leukemia
    102283212 (AKT1)
   05220 Chronic myeloid leukemia
    102283212 (AKT1)
   05218 Melanoma
    102283212 (AKT1)
   05211 Renal cell carcinoma
    102283212 (AKT1)
   05215 Prostate cancer
    102283212 (AKT1)
   05213 Endometrial cancer
    102283212 (AKT1)
   05224 Breast cancer
    102283212 (AKT1)
   05222 Small cell lung cancer
    102283212 (AKT1)
   05223 Non-small cell lung cancer
    102283212 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102283212 (AKT1)
   05017 Spinocerebellar ataxia
    102283212 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102283212 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102283212 (AKT1)
   04931 Insulin resistance
    102283212 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102283212 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102283212 (AKT1)
   05135 Yersinia infection
    102283212 (AKT1)
   05152 Tuberculosis
    102283212 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102283212 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    102283212 (AKT1)
   05161 Hepatitis B
    102283212 (AKT1)
   05160 Hepatitis C
    102283212 (AKT1)
   05164 Influenza A
    102283212 (AKT1)
   05162 Measles
    102283212 (AKT1)
   05168 Herpes simplex virus 1 infection
    102283212 (AKT1)
   05163 Human cytomegalovirus infection
    102283212 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102283212 (AKT1)
   05169 Epstein-Barr virus infection
    102283212 (AKT1)
   05165 Human papillomavirus infection
    102283212 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102283212 (AKT1)
   05142 Chagas disease
    102283212 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102283212 (AKT1)
   01524 Platinum drug resistance
    102283212 (AKT1)
   01522 Endocrine resistance
    102283212 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102283212 (AKT1)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102283212 (AKT1)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102283212 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like PH
Other DBs
NCBI-GeneID: 102283212
NCBI-ProteinID: XP_005911987
LinkDB
Position
Un
AA seq 375 aa
MKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEETMDFRS
GSPGENSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILK
KEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRE
RVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKVLEDNDYGRAVDLWGLGVVMYEMMCG
RLPFYNQDHEKLFELILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQH
RFFASIVWQDVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMEGVDSER
RPHFPQFSYSASGTA
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgaagacggagcggccgcggcccaacaccttcatcatccgctgcctgcagtggaccacg
gtcatcgagcgcacgttccacgtggagacgcccgaggagcgggaggagtggaccaccgcc
atccagacggtggccgacgggctcaagaggcaggaggaggagacgatggacttccggtcg
ggctcacccggcgagaactcgggggccgaggagatggaggtgtcgctggccaagcccaag
caccgcgtgaccatgaatgagtttgagtacctgaagctgctgggcaaaggcaccttcggg
aaggtgatcctggtgaaggagaaggccacaggccgctactacgccatgaagatcctaaag
aaggaggtcatcgtggccaaggacgaggtggcccacacgctcacagagaaccgcgttctc
cagaactcccggcacccgttcctgacggccctcaagtactccttccagacacacgaccgc
ctgtgcttcgtcatggagtacgccaacgggggcgagcttttctttcacctgtcccgggag
cgggtgtttcccgaggaccgggcccgcttctacggcgccgagatcgtgtcggccctggat
tacctgcactcggagaagaacgtggtgtacagggacctcaaggtgctggaggacaacgac
tacggccgggcagtggacttgtgggggctgggcgtggtcatgtacgagatgatgtgcggc
cgcctgcccttctacaaccaggaccacgagaagctctttgagctcattctcatggaggag
atccgcttcccccgcacactcagcccggaggccaagtctctgctctccgggctgctcaag
aaggaccccaagcagcggcttggtgggggctctgaggacgccaaggagatcatgcagcac
cgattctttgccagcatcgtgtggcaggacgtgtacgagaagaagctcagcccgcccttc
aagcctcaggtcacatctgagacggacaccaggtattttgatgaggagttcacggcccag
atgatcaccattacgccacctgaccaagacgacagcatggagggggtggacagcgaacgg
aggccccacttcccccagttctcctactcggccagcggcacggcctga

DBGET integrated database retrieval system