KEGG   Bos mutus (wild yak): 102269372Help
Entry
102269372         CDS       T02919                                 

Gene name
CTH
Definition
(RefSeq) cystathionine gamma-lyase
  KO
K01758  cystathionine gamma-lyase [EC:4.4.1.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00260  Glycine, serine and threonine metabolism
bom00270  Cysteine and methionine metabolism
bom00450  Selenocompound metabolism
bom01100  Metabolic pathways
bom01230  Biosynthesis of amino acids
Module
bom_M00338  Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102269372 (CTH)
   00270 Cysteine and methionine metabolism
    102269372 (CTH)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    102269372 (CTH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102269372 (CTH)
Enzymes [BR:bom01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     102269372 (CTH)
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102269372 (CTH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 GDC-P Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 102269372
NCBI-ProteinID: XP_005898226
LinkDB All DBs
Position
Un
AA seq 440 aa AA seqDB search
MQEKEASPHGFLPRFQHFATQAIHVGQEPEQWTSQAVVPPISLSTTFKQGAPGQHSGFEY
SRSGNPTRNCLEKAVAALDGAKYSLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRY
FRQVATEFGLKISFVDCSKPKLLEAAITPETKLVWIETPTNPSLKMIDIEACAHTVHKHG
DIILVVDNTFMSAYFQRPLSLGADICMYSATKYMNGHSDVVMGLVSLNSESLHDRLRFLQ
NSLGAVPSPIDCYLCNRGLKTLQVRMEKHFENGMAVAQFLESNPQVEKVIYPGLPSHPQH
ELAKRQCTGCPGMVTFYIKGSLQHAETFLQNLKLFTLAESLGGYESLAELPAIMTHASVP
KSDREVLGISDTLIRLSVGLEDKQDLLDDLDQALKAAVSFVLVCVCVCVCVCVQACVCLF
WGGGGNGEATLFIEWPRCSL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaaagaagcctccccacacggattcctgcctaggttccagcatttcgctacg
caggccatccacgtgggccaagaaccggagcaatggacctcccaagctgtagtgccccct
atctcgctgtccaccacgttcaagcaaggggctcctggccagcactcgggttttgagtat
agccgttctggaaatcccacccggaattgcttggaaaaagcagtggcggcgctggatggg
gctaagtacagtttggccttcgcttcaggtttagcagccactgtgaccattacccatctc
ttaaaagcaggagaccagattatttgtatggatgatgtgtatggaggtacaaacaggtac
ttcaggcaggtggcaactgaatttggattaaagatttcttttgttgattgttccaaaccc
aaattgctagaggcagctattacaccagaaaccaagcttgtttggattgaaacccccaca
aaccctagcttgaagatgattgacattgaagcctgcgcacatacggtccataaacatgga
gacatcattttggttgtggataacacttttatgtcagcatatttccagcggcctttgtct
ctgggagctgatatttgtatgtattcagcaacaaaatacatgaatggccacagtgatgtt
gtaatgggcttagtgtcactgaattctgagagccttcatgataggctccgtttcttgcaa
aattctcttggagcagttccatctcctattgactgttacctctgcaatcggggtctgaag
actctacaagtccgcatggagaagcatttcgaaaacggaatggcagttgctcagtttttg
gagtcgaatcctcaggtggaaaaggttatttatcctgggctgccttctcatcctcagcat
gagctggccaagcgtcagtgcacaggttgcccggggatggtcaccttttatatcaagggc
tctcttcaacatgctgaaactttcctccagaacttaaagttatttactctggctgaaagc
ttgggaggatacgaaagtcttgctgagcttccggcaatcatgacccatgcatcagtgcct
aagagtgacagagaagtccttggaattagtgacacacttattcgactctcagtgggctta
gaggataaacaagacctactggatgatctagatcaagctttgaaggcagctgtgagtttt
gttttagtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgcaggcgtgtgtgtgcttattc
tggggggggggggggaatggggaagccactctgtttatagagtggcctcgctgttctctg
taa

DBGET integrated database retrieval system