KEGG   Bos mutus (wild yak): 102282282
Entry
102282282         CDS       T02919                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
bom  Bos mutus (wild yak)
Pathway
bom01521  EGFR tyrosine kinase inhibitor resistance
bom04062  Chemokine signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04217  Necroptosis
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04630  JAK-STAT signaling pathway
bom04659  Th17 cell differentiation
bom04917  Prolactin signaling pathway
bom04920  Adipocytokine signaling pathway
bom04931  Insulin resistance
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04935  Growth hormone synthesis, secretion and action
bom05145  Toxoplasmosis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05167  Kaposi sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05206  MicroRNAs in cancer
bom05212  Pancreatic cancer
bom05221  Acute myeloid leukemia
bom05223  Non-small cell lung cancer
bom05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bom05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102282282 (STAT3)
   04066 HIF-1 signaling pathway
    102282282 (STAT3)
   04068 FoxO signaling pathway
    102282282 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102282282 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102282282 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102282282 (STAT3)
   04062 Chemokine signaling pathway
    102282282 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102282282 (STAT3)
   04917 Prolactin signaling pathway
    102282282 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    102282282 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102282282 (STAT3)
   05206 MicroRNAs in cancer
    102282282 (STAT3)
   05205 Proteoglycans in cancer
    102282282 (STAT3)
   05203 Viral carcinogenesis
    102282282 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102282282 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102282282 (STAT3)
   05221 Acute myeloid leukemia
    102282282 (STAT3)
   05223 Non-small cell lung cancer
    102282282 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102282282 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102282282 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102282282 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    102282282 (STAT3)
   05161 Hepatitis B
    102282282 (STAT3)
   05160 Hepatitis C
    102282282 (STAT3)
   05163 Human cytomegalovirus infection
    102282282 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102282282 (STAT3)
   05169 Epstein-Barr virus infection
    102282282 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102282282 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102282282 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102282282 (STAT3)
Transcription factors [BR:bom03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102282282 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 102282282
NCBI-ProteinID: XP_005899266
LinkDB
Position
Un
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTCLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEDAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEAAQPSAGGQFESLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctccagcagctggacacacggtacttggagcagctccatcag
ctgtacagtgacagcttccccatggagctgcggcagtttctggccccttggattgagagt
caagattgggcatacgcggccagcaaagaatcacatgcgactttggtgtttcataatctc
ttgggagaaattgaccaacagtatagccgcttcctgcaagagtccaatgttctctatcag
cacaatttgcgaagaatcaagcagttccttcagagcagataccttgagaagccaatggag
attgcccgaattgtggcccgttgcctgtgggaagagtcccgcctcctccaaactgcagcc
actgcagcccagcaagggggccaggccaaccaccccacagccgccgtggtaacggagaag
cagcagatgctggagcagcacctgcaggacgtccgcaagcgtgtccaggatctagaacag
aagatgaaagtggtagagaatctccaggatgatttcgatttcaactataaaactctcaag
agtcaaggagacatgcaagatctgaatggaaacaaccagtcggtgaccaggcagaagatg
cagcagctcgaacagatgcttactgccctggaccagatgcggcgcagcatcgtgagtgag
ctggcggggcttttgtcagctatggagtatgtgcagaaaactctcacggatgaagaattg
gctgactggaagaggcgacaacagattgcttgcattggaggccctcccaacatctgccta
gatcggctagaaaactggataacctcattagcagaatctcagcttcagacccgccaacaa
attaagaaactggaggagctgcagcagaaggttagctacaaaggggaccccattgtacag
caccggccaatgctggaggagagaatcgtggagctgtttagaaacttaatgaaaagtgcc
ttcgtagtggagcggcagccctgcatgcctatgcatcctgaccggccattagtcatcaag
accggtgtccagttcacaactaaagtcagattgctggttaaattccctgagctaaattat
caacttaagattaaagtgtgcattgacaaagactccggggacgttgcagctctcagaggg
tcccggaaatttaacattctgggcacaaacacgaaagtgatgaacatggaagagtctaac
aatggcagcctctcagcggagttcaaacacttgaccctgagagagcagagatgcggtaat
gggggccgagccaattgtgatgcctccctgattgtgaccgaggagctgcacctgatcacc
tttgagactgaggtgtatcaccaaggcctcaagattgacctggagacccactccttgcca
gtggtggtgatctccaacatctgtcagatgcccaatgcctgggcgtccatcctatggtac
aacatgctgaccaacaaccccaagaacgtgaactttttcaccaaacccccgatcggaacg
tgggatcaagtggccgaggtgctgagctggcagttctcctctaccaccaagcgcgggctg
agcatcgagcagttgacgacgctggcggagaaactcttaggacctggtgtgaactattca
gggtgtcagatcacatgggctaaattttgcaaagaaaacatggctggcaagggcttctcc
ttctgggtctggctggacaacatcattgacctggtgaaaaagtacatcctggccctttgg
aacgaagggtatataatgggcttcatcagcaaggagagggaacgggccatcttgagcact
aagcccccaggtacctgcctgctgagattcagtgaaagcagcaaagaaggaggcgtcacc
ttcacctgggtggagaaggacatcagcggcaagacccagatccagtcagtggaaccttac
accaagcagcagctgaacaacatgtcatttgctgaaataatcatgggctataagatcatg
gatgccaccaatatcctggtgtctccactggtctatctctaccccgacattccaaaggag
gacgcgttcggaaagtactgtcggccggagagccaggagcatcctgaagctgacccaggt
agtgctgccccgtacctgaagaccaagttcatctgtgtgacaccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaagctgctcaaccctcagcaggagggcagtttgagtccctcacgttcgacatggag
ctgacctcggagtgcgctacctcccccatgtga

DBGET integrated database retrieval system