KEGG   Butyrivibrio proteoclasticus: bpr_I2440Help
Entry
bpr_I2440         CDS       T01292                                 

Definition
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
bpb00260  Glycine, serine and threonine metabolism
bpb00261  Monobactam biosynthesis
bpb00270  Cysteine and methionine metabolism
bpb00300  Lysine biosynthesis
bpb01100  Metabolic pathways
bpb01110  Biosynthesis of secondary metabolites
bpb01120  Microbial metabolism in diverse environments
bpb01130  Biosynthesis of antibiotics
bpb01210  2-Oxocarboxylic acid metabolism
bpb01230  Biosynthesis of amino acids
Module
bpb_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
bpb_M00526  Lysine biosynthesis, DAP dehydrogenase pathway, aspartate => lysine
bpb_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bpb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    bpr_I2440
   00270 Cysteine and methionine metabolism
    bpr_I2440
   00300 Lysine biosynthesis
    bpr_I2440
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    bpr_I2440
Enzymes [BR:bpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     bpr_I2440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT ACT_7 Sorb
Motif
Other DBs
NCBI-ProteinID: ADL35173
UniProt: E0RZQ7
LinkDB All DBs
Position
1:complement(2978096..2979415)
Genome map
AA seq 439 aa AA seqDB search
MKKVVKFGGSSLASAEQFKKVGEIIKADPDRVYVVPSAPGKRNSKDTKVTDMLYKTYALA
EDGKDFKKQLSDIKARYDEIIKGLGLKLSLSDEFKTIEKNFKEKAGKDYAASRGEYLNGI
IMAAYLGYEFIDAATVVAFDKNGEFDGEKTNKLMGKKLEKHERAVIPGFYGAYPDGSVKT
FSRGGSDITGSIVSRAIKADVYENWTDVSGFLVTDPRIIDKPPHIETITYTELRELAYMG
AGVLHEDAIFPVRKEGIPINIRNTNKPEDPGTWIVESTAKKSKYVITGIAGKKGFCCVNV
LKDQMNSEVGFVRKVLQAFEDQNISIEHVPSGIDTMTVFVQQDEFIEKEQAVVSEIHRLA
HPDMLEIESDLALIAVVGRGMKSTRGTAGRIFSALAHASVNVRMIDQGSSELNIIIGVET
RDFEKAIRAIYDIFVTTQI
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggtagttaaatttggtggaagttctcttgcaagtgcagagcagttcaaaaaa
gttggcgagataataaaggcagaccctgacagagtttatgttgtgccttctgctccaggt
aaaagaaattccaaggacactaaggttacagatatgctctacaagacttatgctcttgca
gaggatggcaaagattttaagaaacagctctctgacatcaaagcccgctatgatgagatc
atcaaggggctcggacttaagcttagtctttcagatgagtttaagacaattgagaagaac
tttaaggaaaaggccggaaaagattacgctgccagccgaggagaatacctcaatggtatc
attatggctgcgtatttgggctatgaatttatcgatgcagctacagtagtggcttttgat
aaaaacggcgaatttgacggcgagaagaccaataaactcatgggtaaaaaacttgagaaa
catgaaagagctgttattcccggtttttatggagcttatcctgatggaagtgttaagacc
ttttcaagaggcggttctgatataacaggatcaatcgtttcaagggctatcaaggctgat
gtttatgagaactggacagatgtttcaggattccttgtaacagatccccgcatcattgac
aagccaccgcacatcgagacaatcacatatactgaacttcgagagcttgcgtacatgggc
gcaggagttcttcatgaggatgctattttccctgtccgtaaggaaggaattcctatcaat
atcagaaataccaacaaacctgaggatcctggaacatggattgttgagtcaactgccaaa
aagtccaagtatgttatcacaggaattgcaggtaagaagggcttttgctgcgtaaacgtc
cttaaggatcagatgaactctgaagtaggctttgtccgcaaggtattacaggcctttgaa
gatcagaatatctcaattgagcatgttccttcaggaattgatactatgacagtatttgtt
cagcaggatgaattcatagaaaaagagcaggctgttgtgtcagaaatccacagacttgca
catcctgatatgttggagattgaatcagatcttgctctaattgctgtagtgggacgtgga
atgaaatcaacacgtggtacagccggaagaatcttctcagcacttgctcatgccagcgta
aacgtacgcatgatcgaccagggatcatcagagcttaacatcatcatcggtgttgaaacc
cgcgattttgaaaaagcaatccgtgcaatctatgatatttttgtaactacacagatttaa

DBGET integrated database retrieval system