KEGG   Bordetella pertussis Tohama I: BP1664Help
Entry
BP1664            CDS       T00139                                 

Gene name
gst
Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bpe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BP1664 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpe02000]
    BP1664 (gst)
Enzymes [BR:bpe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BP1664 (gst)
Transporters [BR:bpe02000]
 Other Transporters
  Pores ion channels [TC:1]
   BP1664 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C_3 GST_N_3 GST_N_2 GST_C_2 GST_C 2Fe-2S_Ferredox
Motif
Other DBs
NCBI-GeneID: 2666401
NCBI-ProteinID: NP_880387
UniProt: Q7VXS4
LinkDB All DBs
Position
complement(1751125..1751748)
Genome map
AA seq 207 aa AA seqDB search
MSRWTFYTAPGTCALATHIALHEAGADFDLVKLDFGATQQQSPDYLRVNPKGRVPALATE
HGVLTENPALLAFIAQSFPQAQLAPLGDPFAFARMQELANYLASTAHVAHAHKRRGARWA
DDPAAHEAMRAKIPENMTAIAGYLESQIIGPWALGERFSVVDGYLYTVGSWMEGDSVDMT
RFPKLADYLARVGARPAVQRALAEMNG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgctggaccttctataccgcccctggcacctgtgcgctggcgacgcacatcgcg
ctgcacgaagccggcgccgatttcgatctggtcaagctggatttcggcgccacgcagcag
caaagccccgactacctgcgcgtcaaccccaagggccgcgtgccggcgctggccaccgaa
catggcgtgctgaccgagaaccccgccctgctcgctttcatcgcgcagagctttccgcag
gcgcagctggcgccgctgggcgatccgttcgcgttcgcgcgcatgcaggaactggccaac
tacctggcctccaccgcgcacgtcgcgcacgcgcacaaacggcgcggcgcgcgctgggcc
gacgacccggccgcgcacgaggccatgcgcgccaagatccccgagaacatgacggccatc
gccggctacctggaatcgcagatcatcggcccctgggcactgggcgagcgcttcagcgta
gtcgacggctatctgtacaccgtcggcagctggatggaaggcgacagcgtcgacatgacg
cgctttcccaagctggccgactacctggcgcgcgtcggcgcgcggccggccgtgcagcgc
gcgctggccgagatgaacggctga

DBGET integrated database retrieval system