KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110160837
Entry
110160837         CDS       T05002                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04141  Protein processing in endoplasmic reticulum
bpec04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:bpec00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110160837 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110160837 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bpec03000]
    110160837 (atf6b)
Transcription factors [BR:bpec03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110160837 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 YabA MCU
Other DBs
NCBI-GeneID: 110160837
NCBI-ProteinID: XP_020781168
LinkDB
Position
Unknown
AA seq 730 aa
MSADLLSDLDSRFFADNLLTSEDWDACLYQFEHMEEGDESPALRYDTEFERDLVLTLDPD
NRTSPWRHLDDNLLTGEAPVMKSQMTIAQPLPVDMLFQIKTEPPSPSSSPQSQCPSPDPQ
ILVKGENPPTPPYMFGDVLSPPLGSLEVTVATSAVNQPTSAQTPIQTARQPALQTALQPA
LQPALPAQIQGQIQGQIQAVNAAVTLHTQNTVLSSSSVSKSRCKVPLQPRPVCVTSAPVT
SSSLQTPSPGGTLLLQGLTPMDQTHPVVLSPSVCLSSAPAIVKVEPLSPSIPQCSAAPPT
SKPIVPATANLPGNGSNDIDMKVLKRQQRMIKNRESACQSRRKKKEYLQNLEAQLREAQQ
ENERLRRENQELRDRLAGKEGSDSMSNKRAVCVMALLLFMTFSFGPVSITDRKWADLGDS
AVSYTGRKLLEFEQQNQKQNQKPTNVPPKRTVERSQAEEKERWRTEEDKFSTETYHFRNL
SDAFTDVKDLVLQDIDRFFSSSDCRQFNRSESLRLADELRGWVHRHQIDRKKSGDKPKAV
KKAKIAQKAQLRKANISRYLPIQSHRSIESQLQVLSGPEVTYSDFLDAIDRREDTFYVVS
FRRDHLLLPAISHNKTSRPKMSLVMPAMSVNESLYNASQGYEMMMQVDCEVMDTRIVPIK
SSAVPPSLREPPPPRSPHGNAQHQPHHHGNHTSHHHQQHPQPAAAASSTNHRAPLQRRRP
VEFLIGQSEV
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgagtgcggatctattgtcggatttggactctcgtttcttcgcggataacctcctgacg
agcgaggactgggatgcctgtttgtaccagtttgagcacatggaggagggagacgagagc
ccggcactccgatacgacacagagtttgagcgtgacctggtgctgacccttgaccctgac
aatcgcacgtcgccatggagacacctcgacgacaacctcctcacaggtgaagctccggtg
atgaagagtcagatgaccatcgctcagccgctgcccgtcgacatgttgtttcagatcaaa
acagaaccgccctctccctcctccagccctcagtcccagtgtccctcaccggatccacag
attctagtgaaaggagagaaccccccgactcccccgtacatgtttggggatgtgctgtct
cctccgctggggtcactagaggtcactgtggccacgtcagctgtcaatcaacccacctca
gcacaaacgccaatccaaactgcccgacagcctgccctacaaactgccctacaacctgcc
ctacaacctgccctgcctgctcagatacaggggcagatccaggggcagatccaggcggtc
aatgcagcggtcactctgcacacccagaacactgtcttgtccagttcgtcggtgtctaaa
agcagatgcaaggtccctctgcagccgcgccctgtgtgtgtgacctctgccccagtgacc
agctcctctctgcagacgcccagccctggaggcaccctgctgctccagggactgaccccc
atggaccaaacacacccagtggtgctgtctccgtccgtctgtctctcctcggctcccgcc
atcgtcaaagtggagccgctctctcccagcatacctcagtgctccgcggccccgcccacc
agcaaacccatcgtcccggcgaccgctaatctgcccggcaatggcagcaacgacattgat
atgaaggtcctgaagcggcagcagaggatgataaagaacagagagtcagcctgtcagtcc
aggaggaagaaaaaagaatatctccaaaacctggaggcacaactccgagaagctcagcag
gagaacgagaggctgaggagagagaaccaggagctgagggacaggctggccgggaaagag
ggcagtgactcgatgagtaacaaacgtgccgtctgtgtcatggctctgctgctgttcatg
accttcagcttcggacctgtcagtatcacagacaggaagtgggcggacctcggtgacagt
gcagtttcttacacgggaagaaaactgctggaatttgaacaacagaatcaaaaacagaac
caaaaaccgacaaatgttccaccaaaacgaaccgtggagcgatcacaggcggaggagaag
gagcgatggaggacagaggaggacaagtttagcactgaaacataccacttcaggaatctg
agtgatgcgttcacggacgtgaaagatctggttcttcaggacatcgacaggtttttctcg
tcttcagactgtcggcagtttaatcgctccgagtcgctcaggctggcggacgagctgagg
ggctgggttcacaggcaccagatcgacaggaaaaagtctggagacaaaccaaaggctgtg
aagaaggcaaagatcgctcagaaagctcagctgaggaaagccaacatctccagatacctg
ccgatccagtctcaccgctccatcgagagtcagctgcaggtcctgtctggtccagaggtg
acgtacagtgacttcctggacgccatcgaccgcagagaggacacgttctatgtggtttct
ttcagacgagaccacttgttgctgccggcgatcagccacaacaaaaccagtcggcccaaa
atgtccctggtgatgcccgccatgtctgtgaacgagagcctgtacaacgcgtcacagggc
tatgagatgatgatgcaggtggactgcgaggtcatggacacgcgcatcgtccccataaag
tcgtccgccgtgccgccctccctccgagagccgccgcctccccgctccccccacggcaac
gcgcagcatcagccccatcaccacggcaaccacacctcgcaccaccaccagcaacacccg
cagcccgccgccgcagcctcctccaccaatcacagggctccgctgcagcgacgacgcccg
gtcgagttcctcattggccagtcagaggtgtga

DBGET integrated database retrieval system