KEGG   Paraburkholderia phymatum: Bphy_1359Help
Entry
Bphy_1359         CDS       T00704                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00473  D-Alanine metabolism
bph01100  Metabolic pathways
bph01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bph00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Bphy_1359
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Bphy_1359
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bph01011]
    Bphy_1359
Enzymes [BR:bph01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Bphy_1359
Peptidoglycan biosynthesis and degradation proteins [BR:bph01011]
 Precursor biosynthesis
  Racemase
   Bphy_1359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Ice_nucleation
Motif
Other DBs
NCBI-ProteinID: ACC70541
UniProt: B2JIE7
LinkDB All DBs
Position
1:complement(1526499..1527590)
Genome map
AA seq 363 aa AA seqDB search
MSLRKYPMPRPVSATIHTAALANNLAVARRYAPKSKIWAVVKANAYGHGLARAFPGLRAT
DGFGLLDLEEAVKLRELGWAGPILLLEGFFRPTDIDVIDRYSLTTALHSDEQLRMLEMAR
LSKPVNIQLKMNSGMNRLGYTPEKFRAAWERARACQGVGQITLMTHFSDADSERGISHQM
EAFERGAQGIAGARSLANSAATLWYPEAHFDWVRPGVMLYGASPSGVSSAIKDTGLQPAM
TLASELIAVQTLAQGQTIGYGSTFTAREGMRIGVVACGYADGYPRVAPEGTPIIVDGIRT
RIVGRVSMDMITVDLTPCPQANVGSRVELWGAQLPVDDVAQSCGTIGYELVCAVAPRVPV
RAE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtctttacgaaaatatcccatgccgcgcccagtctcagccacgattcacactgccgct
ctcgccaataatctcgctgtcgcccgtcgctacgcgccgaagtccaagatctgggctgtc
gtcaaggccaatgcgtacggtcacggactcgcgcgggcattcccaggcttgcgcgcaacc
gacggctttggtttgctcgacctcgaagaagcggtgaagttgcgtgaattggggtgggcg
gggccgattttgttgctggagggctttttccggcccaccgatatcgacgtcatcgaccgt
tatagtctgaccacggcgctgcattcggacgagcagttgcgcatgctggaaatggcgcgc
ctgtccaagcccgtcaatatccagttaaagatgaacagcggcatgaaccgcctcggctat
acgccggagaagttccgtgcagcctgggaacgtgcgcgggcctgccagggcgtcggccag
atcacgttgatgacccatttctcggatgccgacagcgagcgcggcatctcgcatcagatg
gaagcattcgagcgtggcgcacagggcattgcgggcgcgcgcagcctcgccaattcggcc
gccacgctgtggtatccggaagcgcatttcgactgggtgcgcccgggcgtgatgctgtac
ggcgcgtcgccgtcgggcgtaagctcggcgatcaaggacacgggcctgcagccggccatg
acgcttgcttcggaactcatcgccgtgcagacgctcgcgcaagggcagacgatcggctat
ggctcgaccttcacggcgcgcgaaggcatgcgcatcggcgtggtcgcgtgcggctatgcg
gacggttatccgcgcgtcgcgccggagggtacgcccatcatcgtcgacggcatccgtacg
cgcatcgtcggtcgtgtgtcgatggacatgatcaccgtcgatctcacgccttgcccgcag
gcgaacgtcggctcgcgtgtggagctgtggggcgcccaactgcccgtcgatgacgtcgcg
cagtcgtgcggcacgatcggctacgagcttgtgtgcgccgtcgcgccgcgcgtgcccgta
cgagccgagtga

DBGET integrated database retrieval system