KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A0364Help
Entry
BURPS1106A_A0364  CDS       T00480                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
bpl  Burkholderia pseudomallei 1106a
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BURPS1106A_A0364
Enzymes [BR:bpl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BURPS1106A_A0364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: ABN94786
UniProt: A3P247
LinkDB All DBs
Position
II:346495..347631
Genome map
AA seq 378 aa AA seqDB search
MPQTAEAPPQRAAEPGETPALPATMRAVVCHGPRDYRLEQVPVPKPGPDEILTQVERVGI
CMGDIKTFRGAPSFWGDAVQPRYVKPPMIPGHEFVCRVVALGPGAERRGVKVGDRVISEQ
IVPCWSCRFCGHGQYWMCQKHDLYGFQNNVHGAMAEYMIFTKEAIVHRVPDSIPTDEAIL
IEPLSCSLHAADRANVGFDDVVVVAGAGTLGLGIIGAVRLRHPKQLIVLDMKPERAALAR
RMGADDVWNPAEENVIEKIRAITGGYGCDIYIEATGHHRAVGQGLAMLRKLGRFVEFSVF
NDEASVDWSIIGDRKELDVLGSHLGPYMYPRAIEFIASRRIDVRGIVTHTFPLSRFADAF
AVMERGEQSLKVVLDPRG
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgccacagacagccgaagcgccgccgcaacgcgcggccgagcccggcgagacgcccgcg
ctgcccgccacgatgcgcgccgtggtttgccacggcccgcgagactaccgcctcgagcag
gtgccggtgccgaagccggggccggacgagatcctgacccaggtggagcgcgtgggcatc
tgcatgggcgacatcaagacgtttcgcggcgcgccgtcgttctggggcgacgcggtgcag
ccgcgctacgtgaagccgccgatgattcccggccacgaattcgtgtgccgcgtcgtcgcg
ctcggccccggcgccgagcggcgcggcgtgaaggtgggcgatcgcgtgatctccgagcag
atcgtgccgtgctggagctgccgcttctgcggccacggccagtactggatgtgccagaag
cacgatctgtacggattccagaacaacgtgcacggcgcgatggccgaatacatgatcttc
acgaaggaggcgatcgtgcaccgcgtgcccgattcgatcccgaccgacgaggcgatcctg
atcgagccgctgtcgtgctcgctgcacgcggccgatcgcgcgaacgtcggcttcgacgac
gtggtcgtcgtcgccggcgcgggcacgctcgggctcggcatcatcggcgcggtgcggctg
cgccatccgaagcaactgatcgtgctcgacatgaagcccgagcgcgcggcgctcgcgcgc
cggatgggcgcggacgacgtgtggaacccggccgaggagaacgtgatcgagaagatccgc
gcgatcacgggcggctacggctgcgatatctacatcgaggcgaccggccaccatcgcgcg
gtaggccaggggctcgcgatgctgcgcaagctcgggcgcttcgtcgagttcagcgtgttc
aacgacgaagcgagcgtcgactggtcgatcatcggcgatcgcaaggagctcgacgtgctc
ggctcgcatctcggcccgtacatgtacccgcgcgcgatcgagttcatcgcatcgcgcagg
atcgacgtgcgcggcatcgtcacgcacacgttcccgctgtcgcgcttcgccgacgcgttc
gcggtgatggagcgcggcgagcaatcgttgaaggtcgttctggatccgcgaggttaa

DBGET integrated database retrieval system