KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_2603Help
Entry
BURPS1710b_2603   CDS       T00289                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00473  D-Alanine metabolism
bpm01100  Metabolic pathways
bpm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BURPS1710b_2603
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BURPS1710b_2603
Enzymes [BR:bpm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BURPS1710b_2603
Peptidoglycan biosynthesis and degradation proteins [BR:bpm01011]
 Precursor biosynthesis
  Racemase
   BURPS1710b_2603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABA48233
UniProt: Q3JR08
LinkDB All DBs
Position
I:complement(2886202..2887272)
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLSVVRRHAAQSKVWAIVKANAYGHGLARVFPGLRGTDGFGLLD
LDEAVKLRELGWAGPILLLEGFFRSTDIDVIDRYSLTTAVHNDEQMRMLETARLSKPVNV
QLKMNSGMNRLGYTPEKYRAAWERARACPGIGQITLMTHFSDADGERGVAEQMATFERGA
QGIAGARSFANSAAVLWHPSAHFDWVRPGIMLYGASPSGRAADIADRGLKPTMTLASELI
AVQTLAKGQAVGYGSMFVAEDTMRIGVVACGYADGYPRIAPEGTPVVVDGVRTRIVGRVS
MDMLTVDLTPVPQAGVGARVELWGETLPIDDVAARCMTVGYELMCAVAPRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatttccgccacgatccacaccgcagctctcgcgaacaacctctccgtc
gtgcgccgccacgccgcccagtcgaaggtctgggcgatcgtcaaggcgaacgcgtatggg
cacggtctcgcgcgcgtctttcccgggctgcgcggcaccgacggcttcggcctgctcgac
ctcgacgaggccgtgaagctgcgcgaactgggctgggcggggccgatcctgctgctcgag
ggcttcttccggtcgaccgacatcgacgtgatcgaccgctacagcctgacgaccgcggtg
cacaacgacgagcagatgcgcatgctcgagaccgcgcggctgtcgaagcccgtgaacgtc
cagctgaagatgaacagcggcatgaaccggctcggctacacgcccgagaagtaccgggcc
gcctgggagcgcgcgcgcgcatgcccgggcatcggccagatcacgttgatgacccatttt
tcggacgccgacggcgaacgcggcgtggccgagcagatggcgacgttcgagcgcggcgcg
caaggcatcgccggcgcgcgcagcttcgcgaactcggccgccgtgctctggcacccgtcg
gcgcacttcgactgggtgcggcccggcatcatgctgtacggcgcgtcgccgtccggccgt
gcggcggacatcgccgaccggggcctgaagccgacgatgacgctcgcctccgagctgatc
gccgtgcagacgctcgcgaaagggcaggcggtcggctacggatcgatgttcgtcgccgag
gacacgatgcgcatcggcgtcgtcgcgtgcggctatgcggacggctatccgcggatcgcg
cccgagggcacgcccgtcgtcgtcgacggcgtgcgcacgcggatcgtcggccgcgtgtcg
atggacatgctgaccgtcgatctcacgcccgtgccgcaggcgggcgtcggcgcgcgcgtc
gagctgtggggcgagacgctgccgatcgacgacgtcgccgcgcgctgcatgacggtcggc
tacgagctgatgtgcgcggtcgcgccgcgcgtgcccgtgcgtgccgagtaa

DBGET integrated database retrieval system