KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0980
Entry
BURPS1710b_A0980  CDS       T00289                                 

Definition
(GenBank) ferredoxin reductase
  KO
K18249  anthranilate 1,2-dioxygenase ferredoxin reductase component [EC:1.18.1.-]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00627  Aminobenzoate degradation
bpm01100  Metabolic pathways
bpm01120  Microbial metabolism in diverse environments
Module
bpm_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BURPS1710b_A0980
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.-  
     BURPS1710b_A0980
SSDB
Motif
Pfam: Pyr_redox_2 Reductase_C Pyr_redox XdhC_C NAD_binding_7 Pyr_redox_3 3HCDH_N AlaDh_PNT_C 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: ABA53519
UniProt: Q3JJW5
LinkDB
Position
II:complement(1245124..1246365)
AA seq 413 aa
MSTADPYLIAGGGHAARRAAETLRERDPAARIVMIGAEPELPYDRPVLSKEALVGGDAGE
RRAFVRDAAWYRERDIELRLGVRVEAIERGARRVRLSDGARLGYARLLIATGSRVRRFAG
PVDAGVHVHYVRTLADTRALRAALAPGKRVAVLGGGFIGLEVAASAVRLGCRATVVDPAP
RLLQRGMPEAVGAFALALHARHGVDVRLGALPERIRRAANGAAVVETSAGGIVADVVVAG
IGVVPNVELAQAAGLDVDDGVCVDEMCRTADPAIFAAGEVTRHFNPLVGRALRIESWQIA
ENQPAVAAANMLGAAETYAQWPWLWSDQYDSNLQTLGLFGGEQTLVLRGSPERDRAFCVF
ALNARRELAAVAAVNAGREIAVCRRLMTAGVALDPARLADPSDALRAMLPRGV
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgtcgacggctgacccgtatctgatcgcgggcggcgggcacgcggcgcgccgcgcggcc
gagacgctgcgcgagcgcgatccggccgcgcgcatcgtgatgatcggcgcggagcccgaa
ttgccgtacgatcggcccgtgttgtcgaaggaggcgctcgtcggcggcgacgctggcgag
cgccgcgcgttcgtgcgcgatgccgcgtggtatcgcgagcgcgacatcgagctgcggctc
ggcgtgcgcgtcgaggcgatcgagcgcggcgcgcggcgcgtgcgcctgagcgacggcgcg
cgcctcggctacgcgcggctgctgatcgcgaccggctcgcgcgtgcggcgcttcgcgggg
cccgtggacgccggcgtgcacgtccactacgtgcgcacgctcgccgatacgcgcgcattg
cgcgcggcgctcgcgccgggcaagcgcgtcgcggtgctgggcggcggcttcatcgggctc
gaggtcgccgcgtcggcggtgcggctcgggtgccgcgcgacggttgtcgatcccgcgccg
cgcctgcttcagcgcgggatgcccgaggccgtcggcgcgttcgcgctcgcgctgcatgcg
cggcacggcgtggacgtgcggctcggcgcgctgccggagcgcatccgccgcgccgcgaac
ggcgcggcggtcgtcgagacgagcgcgggcgggatcgtcgcggacgtcgtcgtcgcaggc
atcggcgtcgtgccgaacgtcgagctcgcgcaggcggcgggcctcgacgtcgacgacggc
gtctgcgtcgacgagatgtgccgcaccgccgatccggcgatcttcgcggcgggcgaggtc
acgcggcatttcaatccgctcgtcggccgcgctctgcggatcgaatcgtggcagatcgcg
gagaaccagccggccgtcgcggcggcgaacatgctcggcgcggccgagacgtacgcgcag
tggccttggctatggtccgatcagtacgacagcaacttgcagacgctcggccttttcggc
ggcgagcagacgctcgtgctgcgcggctcgcccgagcgcgaccgcgcgttctgcgtgttc
gcgctgaacgcgcgccgcgagctggcggcggtcgcggccgtcaacgcggggcgcgagatc
gcagtgtgccgccggttgatgacggcgggcgtcgcgctcgatcccgcgcgtctcgcggat
ccgtcggacgcgctgcgcgcgatgctgccgcgcggcgtgtag

DBGET integrated database retrieval system