KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A2044Help
Entry
BURPS1710b_A2044  CDS       T00289                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bpm  Burkholderia pseudomallei 1710b
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BURPS1710b_A2044 (ahpF)
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BURPS1710b_A2044 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 Glutaredoxin FAD_oxidored AlaDh_PNT_C FAD_binding_3 Thi4 HI0933_like NAD_binding_8 DAO K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: ABA53160
UniProt: Q3JGV8
LinkDB All DBs
Position
II:complement(2487629..2489497)
Genome map
AA seq 622 aa AA seqDB search
MDAGRRHAHAVSRPDRQDLKPRGGAAAVRAMRAEGAVRFVARLRPPCGPFSAVFARFAAP
LPASPAPSPPRPRSTGKAPFRYGIRIVMLDAHLKTQLKSYLERITRPVELVASLDAGDQS
RELRALLDEIAALSPQIFVTERRDAAERAPSFSVGEPGKAAGIRFAGMPMGHEFTSLVLA
LLQTGGHPIKLDDATIEQIRALDGDYAFETYISLTCQNCPEVVQALNVMALVNPRIRHVM
IDGALFQDEVEARRIMAVPTIFLNGETFGQGRSSVKEILAKLDSGASRRAAQALAEKPVF
DMLIVGGGPAGAAAAIYAARKGISTGVVAERFGGQVLDTMAIENFVSVQETEGPKFATAL
EQHVKQYDVDVIDVERADRLVPGRVHEIRLASGAVLKAKTVVLATGARWREIGVPGEREY
RNRGVAYCPHCDGPLFKRKRVAVVGGGNSGVEAAIDLAGLAAAVTLIEYGEQLRADDVLQ
RKLRSLANVTVITQARTTELTGDGAKLNGLVYEDRRTGEAKRIALEGVFVQIGLVPNTEW
LKGTVELSRHGEIVVDARGATSVPGVFAAGDVTTVPYKQIVIAVGEGAKASLGAFDHLIR
SEAHAVQAADIEASANAEAMAA
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgggcgccgacacgctcacgccgtctctcgacctgatcggcaagatctgaag
ccacgcggcggggccgccgccgttcgcgccatgcgggccgagggtgccgtgcgtttcgtg
gcccgtttgcggcccccttgcggcccgttttcagccgttttcgcccgtttcgcggccccg
ctcccggcctcacccgctccatcgccgcctcgcccgcgttcgacgggcaaggcccccttt
cgctatggaatccgaatcgtcatgctcgacgcccatctcaagactcagttgaaatcgtac
ctcgaacggatcacgcgccccgtcgagctcgtcgcatcgctcgacgcaggcgaccagtcg
cgcgagctgcgcgcgctgctcgacgagatcgcggcgctgtcgccgcagatcttcgtgacc
gagcgccgcgacgcggccgagcgcgcgccgtcgttctcggtcggcgagccgggcaaggcc
gcgggcattcgcttcgccggtatgccgatgggccacgaattcacgtcgctcgtgctcgcg
ctgctgcagacgggcggccatccgatcaagctcgacgacgcgacgatcgagcagatccgc
gcgctcgacggcgactacgcattcgagacgtatatctcgctcacctgccagaactgcccg
gaagtcgtacaggcgctcaacgtgatggcgctcgtcaacccgcgcatccgccacgtgatg
atcgacggcgcgctgttccaggacgaagtcgaggcgcgccggatcatggccgtgccgacg
atcttcctgaacggcgagacgttcggccagggccgcagcagcgtgaaggagatcctcgcg
aaactcgacagcggcgcgagccggcgcgcggcgcaggcgctcgcggagaaacccgtgttc
gacatgctgatcgtcggcggcggccccgcgggcgcggcggcggcgatctacgcagcgcgc
aagggcatctcgacgggcgtcgtcgccgagcgcttcggcggccaggtgctcgatacgatg
gcgatcgagaatttcgtgtcggtccaggaaaccgaggggccgaagttcgcgaccgcgctc
gagcagcacgtgaagcaatacgatgtcgacgtgatcgacgtagagcgcgccgaccggctc
gtgccgggccgcgttcatgaaattcgcctcgcgagcggcgcggtgctgaaggcgaagacc
gtcgtgctcgcgacgggcgcgcgctggcgcgagatcggcgtgcccggcgagcgcgagtat
cgcaaccgcggcgtcgcgtactgcccgcattgcgacgggccgctcttcaagcgcaagcgc
gtcgcggtggtcggcggcggcaactcgggtgtcgaggcggcgatcgatctcgccggcctt
gccgccgccgtgacgctgatcgaatacggcgagcagttgcgtgcggacgacgtgctgcaa
cgcaaactgcgcagcctcgcgaacgtgacggtgatcacgcaggcacgcacgaccgagctc
acgggcgacggcgcgaagctgaacgggctcgtctacgaggacaggcgcacgggcgaggcg
aagcgcatcgcgctcgaaggcgtgttcgtgcagatcggcctcgtgccgaacaccgaatgg
ctgaagggaaccgtcgagctgtcgaggcacggcgagatcgtcgtcgacgcgcgcggcgcg
acgtcggtgcccggcgtgttcgccgccggcgacgtgacgacggtgccgtacaagcagatc
gtgatcgcggtcggcgaaggcgcgaaggcatcgctcggcgcattcgaccacctgattcga
agcgaggcgcatgccgtgcaggcggcggatatcgaagcttcggcaaacgccgaggccatg
gccgcctga

DBGET integrated database retrieval system