KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0366Help
Entry
GBP346_A0366      CDS       T00894                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase DacC
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
bpr00550  Peptidoglycan biosynthesis
bpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GBP346_A0366
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bpr01002]
    GBP346_A0366
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpr01011]
    GBP346_A0366
Enzymes [BR:bpr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     GBP346_A0366
Peptidases [BR:bpr01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   GBP346_A0366
Peptidoglycan biosynthesis and degradation proteins [BR:bpr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   GBP346_A0366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ACQ96495
UniProt: C4KNU4
LinkDB All DBs
Position
I:321280..322593
Genome map
AA seq 437 aa AA seqDB search
MRLSSLGLTSLASSTAIAVAARNVALGIVLPAALVSTIAVAQAKPAAKAKHAAAPAAAAA
PTGAPATYVPGAVPPPGVNARSWVLVDASSNQVLASGNADERVEPASLTKLMTAYLVFEA
LDAKKITMEQIVTPSEAVRRVGRDESRMFIEANKPVSVHDLVYGMIIQSGNDAAIALAEL
VGGSEAQFVNMMNAEAQRLGMKSTHFADVNGMPDPNHYTTAGDLAKLSTHLIRDYPDYYN
IFSVKEFTYNNIKQPNRNRLLWLDPTVDGLKTGHTQAAGYCLIASAKRALPGAADATRRL
VTVMMGETKESDRVQDSMKMLNYGYTAFDSVRLYKASQPIDTPRVYKGKSNNVQVGVKKD
QFITVPRGLADKVKPEVALNAPLIAPLADGQVVGSVKLVADGKTVAEFPVVALQPVPEAG
LLGRIWDSILLMFSKKK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgtcttccctcggcctcacgtcactcgcttcctccaccgccattgccgtcgcc
gcgcgtaacgtcgcgctcggcatcgtgctgcccgccgcgctcgtgtcgacgatcgccgtc
gcgcaggcgaagcccgccgccaaggcgaagcatgcggccgcgccggccgccgccgccgcg
ccgacgggcgcgcccgccacgtacgtgccgggcgccgtgccgccgccgggcgtgaacgcg
cgctcgtgggtgctcgtcgatgcgtcgagcaatcaggtgctcgcctccggcaacgccgac
gagcgtgtcgagcccgcgtcgctcacgaagctgatgacggcctacctcgtgttcgaggcg
ctcgacgcgaagaagatcacgatggagcagatcgtcacgccgagcgaggcggtgcgccgc
gtcggccgcgacgaatcgcggatgttcatcgaggcgaacaagcccgtgagcgtgcacgat
ctcgtctacgggatgatcatccagtcgggcaacgacgcggcgatcgcgctcgccgagctc
gtcggcggcagcgaagcgcagttcgtcaacatgatgaacgctgaagcgcagcgcctcggg
atgaagagcacgcacttcgccgacgtgaacggcatgcccgacccgaatcactacacgacg
gcgggcgacctcgcgaagctgtcgacgcatctgatccgcgactatccggattactacaac
atcttctcggtcaaggaattcacgtacaacaacatcaagcagccgaaccgcaaccggctg
ctgtggctcgatccgaccgtcgacggcctgaagaccggccacacgcaggcggcgggctac
tgcctgatcgcgtcggcgaagcgcgcgctgccgggcgcggcggacgcgacgcgccgcctc
gtcaccgtgatgatgggcgagaccaaggagagcgaccgcgtgcaggacagcatgaagatg
ctgaactacggctacaccgcgttcgattcggtgcgcctgtacaaggctagccaaccgatc
gacacgccgcgcgtctacaagggcaagagcaacaacgtgcaggtcggcgtgaagaaggac
cagttcatcaccgtgccgcgcggcctggcggacaaggtgaagccggaagtcgcgctgaac
gcgccgctcatcgcgccgctcgcggacggccaggtggtgggctcggtgaagctcgtcgcc
gacggcaagacggtggcggaattcccggtcgtcgcgctgcagccggtgccggaagcgggc
ctgctcggccgcatctgggattcgatcctgctgatgttcagcaaaaagaagtaa

DBGET integrated database retrieval system