KEGG   Basilea psittacipulmonis: IX83_01775Help
Entry
IX83_01775        CDS       T03226                                 

Definition
(GenBank) fumarate reductase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bpsi  Basilea psittacipulmonis
Pathway
bpsi00020  Citrate cycle (TCA cycle)
bpsi00190  Oxidative phosphorylation
bpsi00650  Butanoate metabolism
bpsi01100  Metabolic pathways
bpsi01110  Biosynthesis of secondary metabolites
bpsi01120  Microbial metabolism in diverse environments
bpsi01130  Biosynthesis of antibiotics
bpsi01200  Carbon metabolism
Module
bpsi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpsi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpsi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IX83_01775
   00650 Butanoate metabolism
    IX83_01775
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    IX83_01775
Enzymes [BR:bpsi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     IX83_01775
    1.3.5.4  fumarate reductase (quinol)
     IX83_01775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO GIDA HI0933_like FAD_binding_3 Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIL32208
UniProt: A0A077DGE9
LinkDB All DBs
Position
374523..376304
Genome map
AA seq 593 aa AA seqDB search
MKGLTSATIPRRHFDAVVVGAGGAGMRCSLQLAQAGLKVAVLSKVFPTRSHTVAAQGGIG
ASLGNMSEDNWYWHMYDTVKGSDWLGDQDAIEFMCREATSAVYELEHFGMPFDRNADGTI
YQRPFGGHTANFGEKPVQRACAAADRTGHALLHTLYQRNVAARTQFFVEWMALDLVRDAD
GAVVGVTALEMETGDIYLFEAKQTVLATGGAGRIWAASTNAFINTGDGLGMVARAGIPLQ
DMEFWQFHPTGVSGAGVLITEGVRGEGGYLLNKDGERFMERYAPTLKDLAPRDFVSRSMD
QEIKEGRGCGPNKDHVLLKLDHLGEEVIKKRLPSIREIAIRFGNVDPCKDPIPVVPTIHY
MMGGIPANYHGQVVTWKDGKEEVVPGLYAVGECAAVSVHGANRLGTNSLLDLVVFGRAAG
NHIVNSHPERQKANSEATNESIDRSLHRVLELENRTSGASVAETGQAIRLTMQQHCGVFR
TLDLLNKGVEKIDELVPQAHNIYFKDKSKVFNTARIEALELLNMIEVARATVKSAANRTE
SRGAHALNDHPERDDENWLRHTLWHSEDGRLEYKPVHMKPLTVDTFPPKPRTF
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgaagggattgactagtgctacgattcctcgtcgtcattttgatgcggttgtggtagga
gcaggtggtgctggtatgcgttgttctttgcaacttgcccaagcaggtctaaaagttgct
gtactctcaaaagtattccccactcgttcgcacacggttgcagcccaaggcggtattggt
gcgtctttagggaatatgagcgaggataattggtattggcacatgtatgataccgtgaaa
ggttcggattggttaggtgaccaagatgccatcgaatttatgtgtcgtgaagcaaccagt
gcggtatatgagttagaacattttggtatgccatttgaccgtaatgctgatggtacgatt
tatcagcgtcctttcggtggtcataccgcgaattttggtgaaaaacctgtacaacgtgcc
tgtgcggcagctgaccgtacggggcatgctttgttacacacgctataccaacgtaacgtt
gctgctcgcacacagttctttgtagaatggatggcattagatttagtgcgtgatgcagac
ggtgctgtggtgggtgtcacggcacttgagatggaaacaggcgacatctatttatttgaa
gcgaaacaaacagtacttgcaacaggtggtgcaggtcgtatttgggctgcgtcaacgaat
gcctttattaacacgggtgacggtctaggtatggtggctcgtgcaggtattcctctacaa
gatatggagttttggcaattccacccaacaggcgtgtcaggtgcaggcgtgttgattaca
gagggtgttcgcggtgagggcggttatctgttgaacaaagatggcgaacgctttatggaa
cgttatgctcctacactgaaagatttggctcctcgtgactttgtttctcgttcgatggac
caagaaattaaagagggtcgtggttgtggaccaaataaagatcacgtattgttaaaactt
gatcaccttggcgaagaagtgatcaaaaaacgtttaccgtctattcgtgagatcgcgatt
cgttttggtaacgtggatccatgtaaagatccgattccagtggtaccgactatccactat
atgatgggtggtattccagcaaattatcatggtcaagtggtgacttggaaagatggtaaa
gaagaagtggtacccggtttatatgcagtaggcgaatgtgcggcagtatctgtacatggt
gctaaccgtttaggtacgaactcattgttagacttggtggtatttggtcgtgcggcgggt
aaccatattgtaaatagtcacccagaacgccaaaaagcgaattcagaagcgacaaatgag
tctattgaccgttcattacatcgtgtgcttgagttggaaaatcgtacttcaggtgcatcg
gtagctgagacaggacaggcgattcgtttaacgatgcaacagcattgcggggtattccgt
acgcttgacttgctcaacaaaggcgttgagaagattgatgaattggttccacaggcccat
aatatctatttcaaagataaatcaaaagtattcaataccgctcgtatcgaggcgttggaa
ttgttgaatatgattgaagtggcacgtgcgaccgtgaaatctgctgcaaatcgcacagaa
agtcgtggtgctcatgctttaaatgatcacccagagcgtgatgatgaaaactggttgcgt
catactttatggcattcagaagatggacgtcttgagtataaacctgttcatatgaaaccg
ttaacagtggatacattccctcctaaaccacgtacattctaa

DBGET integrated database retrieval system