KEGG   Burkholderia pseudomultivorans: WS57_00135
Entry
WS57_00135        CDS       T04870                                 

Definition
(GenBank) ABC transporter
  KO
K04754  phospholipid-binding lipoprotein MlaA
Organism
bpsl  Burkholderia pseudomultivorans
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    WS57_00135
SSDB
Motif
Pfam: MlaA
Other DBs
NCBI-ProteinID: AOI87317
LinkDB
Position
2:complement(36661..37662)
AA seq 333 aa
MNKVRIIAATVAASAMLAGCATGPNRNPNDPLEPMNRTMYKFNDAVDSNIAVPIAKGYQK
ITPTPVRTAISNFFSNLGDLGNMANNLLQLRITDATQDLMRVAMNSVFGVGGLIDIATPA
GLPKHHQDFGLTLARWGVPSGPYLVLPVFGPSTFRDGVGRAVDVRFNLLNYIEPAVRNPM
YIAQFISARSDLLGATDLLKQAALDPYSFVRDAYLQQRKSLTYHGQSSAGLPSYSEPGEA
GAVPAATPAAPGLPNYEDPGESGGGTGAAPGNAPAAPGLPQYNDPGADTATPASAPAAAS
ATAPAGSTTAPAASGAPIAPAVPSVPASGPAAQ
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgaataaggtgcgaatcatcgcggcgacggtcgccgcaagcgcgatgctggccggctgc
gcgacgggccccaaccgcaacccgaacgacccgctcgagccgatgaaccggacgatgtac
aagttcaacgacgccgtcgactcgaacatcgcggtgccgatcgcgaagggttaccagaag
atcacgccgacgcccgtgcgcaccgcgatcagcaacttcttctcgaacctcggcgatctc
ggcaacatggcgaacaacctgttgcagctgcgcatcaccgatgcgacgcaggatctgatg
cgcgtcgcgatgaactcggtgttcggcgtcggcggcctgatcgacatcgcgacgccggcc
gggctgccgaagcatcaccaggacttcgggctgacgctcgcgcgctggggcgtgccgtcg
ggtccgtacctcgtgctgccggtgttcgggccgagcacgttccgcgacggcgtcggccgc
gcggtcgacgtgcgcttcaacctgctcaactacatcgagccggccgtgcgcaacccgatg
tacatcgcgcagttcatcagcgcgcgctcggacctgctcggcgcgaccgacctgctgaag
caggccgcgctcgatccgtactcgttcgtgcgcgacgcgtacctgcagcagcgcaagtcg
ctcacgtatcacggccagtcgtcggccgggctgccgagctacagcgagccgggcgaagcg
ggcgccgtgccggcggcaacgccggccgcgccggggctgccgaattacgaggatccgggc
gagtcgggcggcggaacgggcgccgcgcccggtaatgcgccggctgcgccgggcctgccg
cagtacaacgatccgggtgcggacaccgcgacgccggccagcgcgccggctgccgcgtcg
gccaccgcaccggccggctcgacgacggcgcccgccgccagcggtgcgccgatcgcgccg
gccgtgccgagcgtgccggcgagcggtccggccgcgcagtaa

DBGET integrated database retrieval system