KEGG   Burkholderia pseudomultivorans: WS57_00165
Entry
WS57_00165        CDS       T04870                                 

Definition
(GenBank) histidine kinase
  KO
K02480  two-component system, NarL family, sensor kinase [EC:2.7.13.3]
Organism
bpsl  Burkholderia pseudomultivorans
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bpsl01001]
    WS57_00165
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bpsl02022]
    WS57_00165
Enzymes [BR:bpsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     WS57_00165
Protein kinases [BR:bpsl01001]
 Histidine kinases
  NarL family
   WS57_00165
Two-component system [BR:bpsl02022]
 NarL family
  Unclassified
   WS57_00165
SSDB
Motif
Pfam: sCache_2 dCache_2 HisKA_3 Cache_3-Cache_2 HATPase_c HATPase_c_2 sCache_3_2
Other DBs
NCBI-ProteinID: AOI87323
LinkDB
Position
2:complement(44337..45719)
AA seq 460 aa
MKLKAKIFLLAIVPFLLAIAGIGFGVRQQATSLARTQHATIQAAYLSSKEVELKHYVELA
TSAIMPLYDASGRNARDDAMLRTQALAMLQKMDFGPDGYFFVYDLHGNALMHPREPERVG
HNYWSMRDPQGALTIQQLIGAAMHGGGYVRYVWQRPSTGRAAPKLGYVVALERWGWMVGT
GIYLDDVDTALQRIDARASANIERTMSWLTAIALAGAAAIAVCALVLNVSESRSADAKLK
QLAQRVVESQEQERARLSRELHDGISQMMVSAKLMLESALARFERGAARLPEAEQALASG
VVRLGDTLREVRRISHALRPAMLDDLGLAAALEQLIREFGAQSGIDIGYTQVAHSGARPL
PAAVNTALFRIAQEALSNIVHHAHASRAAVTLDVGAQAVTLTIADNGCGFDAERSQADAR
GGIGLRNMRERLDALGGRLTIASQVGHTIVTARVPLPSAA
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaaactcaaggcaaagatctttctcctcgccatcgtgccgttcctgctcgcgatcgcc
gggatcggcttcggcgtgcgccagcaggcgacctcgctcgcccgcacgcagcacgcgacg
atccaggccgcctatctgtcgagcaaggaagtcgagctgaagcactacgtcgaactcgcg
accagcgcgatcatgccgctctacgacgcgagcggccgcaacgcgcgcgacgacgcgatg
ctgcgcacgcaggcgctcgcgatgctgcaaaagatggatttcgggccggacggctatttc
ttcgtctacgacctgcacggcaacgcgctgatgcatccgcgcgagcccgagcgcgtcggc
cacaactactggtcgatgcgcgacccgcaaggcgcgttgacgatccagcagctgatcggc
gcggcgatgcacggcggcggctacgtgcgctacgtgtggcagcggccgtcgacgggccgg
gccgcgccgaagctcggctatgtcgtcgcgctcgaacgctggggctggatggtcggcacc
ggcatctatctcgacgacgtcgataccgcgctgcagcgcatcgacgcgcgcgcgtccgcg
aacatcgagcgcacgatgagctggctcaccgcgatcgcgctcgccggcgcggcggcgatt
gccgtctgtgcgctggtgctgaacgtcagcgaatcgcgcagcgccgacgcgaagctcaag
cagctcgcgcagcgcgtcgtggaatcgcaggaacaggagcgcgcgcggctgtcgcgtgag
ctgcatgacgggatcagccagatgatggtgtccgcgaagctgatgctcgaatcggcgctc
gcgcgcttcgagcgcggcgcggcgcgcctgcccgaggccgagcaggcgctcgcgtcgggc
gtggtgcgcctcggcgacacgctgcgcgaagtacggcgcatctcgcacgcgctgcgtccc
gcgatgctcgacgatctcggcctcgcagccgcgctcgagcagctgattcgcgagttcggc
gcgcaaagcggcatcgacatcggctatacgcaggtcgcgcacagcggcgcgcggccgctg
ccggcggccgtcaacaccgcgctgttccggatcgcgcaggaagcgctcagcaacatcgtg
catcatgcgcacgcgtcgcgcgccgccgtcacgctcgacgtcggcgcgcaggccgtcacg
ctgacgatcgccgacaacggctgcggcttcgacgccgagcgctcgcaggccgacgcgcgc
ggcggcatcggcctgcgcaacatgcgcgagcgtctcgacgcgctcggcggcaggctgacg
atcgcgtcgcaggtcggccataccatcgtgaccgcgcgcgtgccgctgccgagcgccgcg
taa

DBGET integrated database retrieval system