KEGG   Burkholderia pseudomultivorans: WS57_00180
Entry
WS57_00180        CDS       T04870                                 

Definition
(GenBank) hypothetical protein
  KO
K11477  glc operon protein GlcG
Organism
bpsl  Burkholderia pseudomultivorans
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    WS57_00180
SSDB
Motif
Pfam: Haem_degrading GAF_2 PocR
Other DBs
NCBI-ProteinID: AOI89626
LinkDB
Position
2:complement(50159..50563)
AA seq 134 aa
MQTKPELEFADADRMLAAARAEAERHGWCVSIAIVDDGGHLLAFARLDGASPASASIAQE
KARAAALGRRETKAYEDMINNGRTAFLSAPLTGLLEGGVPVTVGGRIAGAIGVSGVKSEQ
DAQIARAGTQSVAA
NT seq 405 nt   +upstreamnt  +downstreamnt
atgcagacgaaacccgaactcgaattcgccgacgccgaccgcatgctcgccgccgcccgc
gcggaagccgagcgccacggctggtgcgtgtcgatcgcgatcgtcgacgacggcggccac
ctgcttgcgttcgcacgcctcgacggcgcgtcgcccgcgagcgcgagcatcgcgcaggag
aaggcgcgcgcggcggcgctcggccgccgcgaaacgaaagcctatgaggatatgatcaac
aacggccgcaccgcgtttctcagcgcgccgctgacgggcttgctcgaaggcggcgtgccg
gtcacggtcggcggccggattgcgggcgcaatcggcgtgtctggcgtaaagtccgaacag
gatgcgcagatcgcccgcgccggcacacaaagcgtcgcggcctga

DBGET integrated database retrieval system