KEGG   Burkholderia pseudomallei MSHR511: BBQ_5689
Entry
BBQ_5689          CDS       T03012                                 

Definition
(GenBank) 2-aminoethylphosphonate aminotransferase family protein
  KO
K03430  2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
bpsm00440  Phosphonate and phosphinate metabolism
bpsm01100  Metabolic pathways
bpsm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BBQ_5689
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpsm01007]
    BBQ_5689
Enzymes [BR:bpsm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.37  2-aminoethylphosphonate---pyruvate transaminase
     BBQ_5689
Amino acid related enzymes [BR:bpsm01007]
 Aminotransferase (transaminase)
  Class V
   BBQ_5689
SSDB
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP Aminotran_1_2 Beta_elim_lyase SHMT
Other DBs
NCBI-ProteinID: AHG37269
LinkDB
Position
2:2754503..2755570
AA seq 355 aa
MLLLNPGPVTLTERVRQSLLQPDLCHRESEFFDLQDEARARLVAAYALDPAEWSAVLMTG
SGTAAVESMIAALVPENGKLLVIENGVYGERITQIATQYRIAHDVLKHDWMQAPDLARVA
EKLDADRAITHVAVIHHETTTGRLNDLDALAAVCRARGVRMLVDGVSSFGAEAIDFAGGD
IDALAATANKCLHGVPGAAFVIVRRRALASAASRTYYLDLGRLAKLQDARNTPFTPSVHA
YYALVEALREFDEAGGWRARHARYAALAEQVRAGLAARGMPLVLPDGESSVVLRAYRLPA
GVAYEQLHDGLKARGFVIYAGQGGLSSALFRVSTMGAIEPADVERLLDGFTALAR
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgctgttgctgaatcccggtcccgtgacgctgacggagcgtgtgcgccaaagcctgctg
cagccggacctgtgccaccgcgaaagcgaattcttcgatctgcaggacgaggcgcgcgcg
cggctcgtcgccgcgtacgcgctcgatccggccgaatggagcgcggtgctgatgacgggc
tccggcacggccgcggtcgagagcatgatcgccgcgctcgtgccggaaaacggcaagctg
ctcgtgatcgagaacggcgtgtacggcgagcggatcacgcagatcgcgacgcagtaccgg
atcgcgcacgacgtgctgaagcacgactggatgcaggcgccggatctcgcgcgcgtcgcc
gagaagctcgacgcggatcgcgcgatcacgcatgtcgcggtgatccatcacgaaacgacc
acgggccgcctgaacgacctcgacgcgctcgccgccgtgtgccgcgcgcgcggcgtgcgc
atgctcgtcgacggcgtgagcagcttcggcgcggaggcgatcgatttcgcgggcggcgac
atcgacgcgctcgccgcgaccgcgaacaagtgcctgcacggcgtgccgggcgcggcgttc
gtgatcgtgcgccgccgcgcgctcgcgagtgccgcgagccgcacctactacctcgatctc
ggccggctcgcgaagctgcaggacgcgcgcaacacgccgttcacgccgtcggtgcacgcg
tactacgcgctcgtcgaggcgctgcgcgagttcgacgaggcgggcggctggcgcgcgcgc
cacgcgcgctacgcggcgctcgccgaacaggtgcgcgccggcctcgccgcgcgcggcatg
ccgctcgtgctgccggacggcgaatcgtcggtcgtgctgcgcgcgtaccggctgcccgcc
ggcgtcgcgtacgagcaactgcacgacggcctgaaagcgcgcggcttcgtgatctacgcg
ggccagggcgggctgtcgagcgcgttgttccgcgtgtcgacgatgggcgcgatcgagccc
gcggacgtcgagcgcctcctcgacggattcaccgcgcttgcgcgctga

DBGET integrated database retrieval system