KEGG   Paraburkholderia phenoliruptrix: BUPH_00282Help
Entry
BUPH_00282        CDS       T02300                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bpx  Paraburkholderia phenoliruptrix
Brite
KEGG Orthology (KO) [BR:bpx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BUPH_00282
Enzymes [BR:bpx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BUPH_00282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like Glutaredoxin DAO K_oxygenase Thi4 FAD_binding_3 FMO-like FAD_oxidored NAD_binding_8 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AFT87752
UniProt: K0DT01
LinkDB All DBs
Position
2:complement(126287..127879)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLKTYLEKVSRPIEIVASLDDSAKSQELLALLNDIATLSERVSVVERRDDNE
RKPSFSIGEPGKDIGIRFAGIPMGHEFTSLVLALLQVGGHPVKLDDAVIEQIRSLDGDYQ
FETYFSLSCQNCPEVVQALNVMALINPRIRHVAIDGALFQNEVEARQIMAVPTMFLNGEV
FGQGRSGVKEILAKLDTNAGARAAKELEKKPVFDTLIVGGGPAGAAAAIYSARKGIVTGV
VAERFGGQVLDTLAIENFVSVTETEGPKFATALEQHVKTYEVDIMDVQRAEALIPGRINE
VRLANGAVLKARTIILATGARWREINVPGEREYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVREVTLLEFGATLRADEVLQRKLRSLPNVTVITQAQTTEITGDGKKV
NGLVYKDLRSDEVKQIELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLSAFDHLIRNSEETEAANEVEAEAAV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgccaatctcaagactcagttgaaaacgtacctcgaaaaggttagcaggcct
atcgagatcgtcgcgtcgctcgacgacagcgcaaaatcgcaagagctgctggcattgctg
aacgatatcgcgacgttgtcggagcgcgtgagcgtcgtggagcgtcgcgacgacaacgag
cgcaagccgtcgttttcgatcggcgagccgggcaaggacatcggcatccgcttcgcgggc
attccgatggggcatgaattcacgtcgctcgtgcttgcattgctgcaggtcggcggccat
ccagtcaaactcgacgacgccgtgatcgaacagatccgcagtctcgacggcgactatcaa
ttcgaaacgtatttctcgctctcgtgccagaactgcccggaagtggtgcaggcgctgaac
gtgatggcgttgatcaacccgcgcatccgtcacgtggccattgacggcgcgctgttccag
aacgaagtcgaagcacgccagatcatggcggtgccgaccatgttcctgaacggcgaagtg
ttcggccagggccgcagcggcgtgaaggaaatcctcgcaaagctcgatacgaacgccggc
gcccgtgcggcgaaggaactggaaaagaagccggtgttcgacacgctgatcgtcggcggc
gggccggcgggcgcggcggcggcgatctattcggcacgcaagggcatcgtcacaggcgtg
gtcgcggaacgcttcggtggccaggtgctcgacacgctcgctatcgaaaacttcgtgtcc
gtcaccgaaaccgaagggccgaaattcgccaccgcgctcgaacagcacgtgaaaacgtac
gaagtcgacatcatggacgtgcagcgtgccgaagcgctgattccggggcgcatcaacgaa
gtgcgcctcgcaaacggcgcggtgctgaaggcccgaaccatcattctcgcgacgggtgcg
cgttggcgcgaaatcaacgtgccgggcgagcgcgagtatcgcaatcacggcgtggcgtac
tgcccgcactgcgacggtccgctcttcaagggcaagcgtgtcgcggtgatcggcggcggc
aactcgggtgtggaggcggcaatcgacctcgcgggtatcgtgcgcgaagtcacgctgctc
gagttcggcgcgactttgcgtgccgacgaagtgctgcaacgcaagctgcgcagcctgccc
aatgtgaccgttatcacgcaggcgcagaccaccgaaatcaccggcgacggcaagaaggtc
aatggcctcgtctacaaggacctgcgttccgatgaagtgaagcagatcgaactggaaggc
gtgttcgtgcagatcggcctcgtgccgaacaccgagtggctgaagggcacggtggaactg
tcgaagcacggcgagatcgtggtcgatgcacgcggcgcgacgtcggtgccgggcgtgttc
gcggccggcgacgtgaccaccgtgccgttcaagcagatcgtgattgcggtcggcgaaggt
gcgaaggcatcgcttagcgcattcgatcatctgattcgcaatagtgaggaaaccgaagcg
gcgaacgaggtggaagccgaagcggcagtgtga

DBGET integrated database retrieval system