KEGG   Paraburkholderia phytofirmans: Bphyt_5999Help
Entry
Bphyt_5999        CDS       T00765                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00440  Phosphonate and phosphinate metabolism
bpy01100  Metabolic pathways
bpy01120  Microbial metabolism in diverse environments
bpy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Bphyt_5999
Enzymes [BR:bpy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Bphyt_5999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase NAD_binding_7 YfdX
Motif
Other DBs
NCBI-ProteinID: ACD20332
UniProt: B2T864
LinkDB All DBs
Position
2:complement(2227181..2228926)
Genome map
AA seq 581 aa AA seqDB search
MNAREPAFVSASRSARLRQMLVSNELEFMMEAHNGLSARIVREAGFKAIWGSGLAISAQY
GVRDNNEASWTQVVDTLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADMDEFCGKIKAGKDSQSDENFSIVARVEALIAGWGMDEALR
RAEAYRQAGADAILIHSKLSRPDEILEFAREWAGRGPLVIVPTKYYSTPTEVFREAGIST
VIWANHLIRAATSAMQAVAKEIHTSETLVNVEDSIAAVNEIFRLQDADEYSEAEDRYLSS
GRAAGAAVVLAASRGKGLEAVTEDRPKVMLPIAGKPLLRWLVDAFKKQGVNDITVVGGYR
ADAIDTAGIKLVVNEQHAQTGELASLACAIDKLAGDTVVSYGDLLFRSYILRDLVESEAA
FSVVVDSSLTDAENASVRDFAWCSAADDRGLFGNKVLLRHVSSGQDASSAIASQTPHGRW
VGLLNVRGEGRGRLQAVMKQLQARADFASLDMPALLNALIEAGESIEVQYVHGHWRGVND
LEDFRRAGDFAHAQAPFAAAVGAAEKGTANGATNAASGAAQ
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccgcgaacccgctttcgtctccgcttcccgtagcgcgcgcctgcgccagatg
ctcgtcagcaacgaactcgaattcatgatggaggcccataacggcctgtccgcccgcatc
gtccgcgaagccggcttcaaggccatctggggttcgggccttgcaatctccgcgcaatac
ggcgtgcgcgacaacaatgaagcaagctggacgcaagtggtcgacacgctcgaattcatg
gccgacgccagcgatctgccgatcctgcttgacggcgataccggctacggcaacttcaac
aatgtgcgccgcctcgtgcgcaaactcgaacagcgcggcattgccggcgtgtgtatcgaa
gacaagcagttccccaagaccaacagcttcatcaacggcgaagcgcaaccgctcgccgat
atggacgagttctgcggcaagatcaaggccggcaaagactcgcagtccgacgagaacttt
tcgatcgtcgcgcgggttgaagcgttgatcgccggctggggcatggacgaagcgctgcgt
cgcgcggaagcgtatcgccaggcgggcgcggacgcgatcctgattcacagcaagctgtcg
cgtcccgacgaaattctcgagttcgcgcgcgaatgggccggccgcggcccgctcgtgatc
gtgccgaccaagtactacagcacgccgaccgaagtgttccgcgaggccggcatcagcacg
gtgatctgggcgaaccatctgatccgcgcggcgacttcggcgatgcaagccgtcgccaag
gaaatccacacgagcgaaacgctcgtcaatgtggaagacagcattgccgccgtcaacgaa
attttccgcctgcaagacgccgacgaatactcggaagcggaagaccgttatctgtcgagc
ggtcgtgcagccggtgccgcggtcgtgctcgcggcaagtcgcggcaagggcctcgaagcc
gtcacagaagaccgtccgaaagtgatgctgccgatcgccggcaagccgctgctgcgctgg
ctcgtcgatgcgttcaagaagcagggcgtgaacgacattaccgtggtcggcggctatcgc
gcggatgcgatcgacacggccggcatcaagctcgtcgtcaacgaacagcatgcgcaaacc
ggtgaactcgcgtcgctcgcctgcgcgatcgacaagctggccggcgacacggtggtgtcg
tatggcgacctgctgttccgcagctacatcctgcgcgatctggtggagagcgaagcggcg
ttcagcgtggtggtcgattcgtcgttgaccgacgcggaaaacgccagcgtgcgtgacttc
gcctggtgttcggccgccgacgaccgtggtttgttcggcaataaggtcctgctgcgtcat
gtgtcgagcgggcaggatgcatcctcggcaatcgcgtcgcaaacaccgcatggccgctgg
gtcggtttgctgaacgtgcgcggtgaaggccgtggacgtttgcaggctgtgatgaagcag
ttgcaggcgcgcgcggatttcgcgtcgctcgatatgcccgcgttgctgaatgcgctgatc
gaagcaggcgaatcgatcgaagtgcagtacgtgcacggccactggcgcggcgtgaacgac
ctggaagacttccgtcgcgcgggtgacttcgcgcatgcccaagcgccgttcgcggccgct
gtgggtgcggcggagaaagggacggcaaacggcgcgacgaacgcagccagcggagccgcg
caatga

DBGET integrated database retrieval system