KEGG   Burkholderia pyrrocinia: ABD05_21195Help
Entry
ABD05_21195       CDS       T03962                                 

Definition
(GenBank) 2,4-dihydroxyacetophenone dioxygenase
Organism
bpyr  Burkholderia pyrrocinia
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AKM02718
UniProt: A0A0G3WY28
LinkDB All DBs
Position
2:1097048..1097581
Genome map
AA seq 177 aa AA seqDB search
MVDQAVAEFWQNIPPIANPFKPDALPEAYIANAATDDERYYVPFTETVSSRPLWISPSQN
KWCDILMAKEAGLVNRHYHPHEVFAYTLSGKWGYLEHEWTATKGDFVYETPGEGHTLVAF
DHPEPMRAFFIVKGPLIWLDEEGNPDGYFDVHSYIAMCKAHYEKVGLGAQAIEKLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgaccaagccgtagccgaattctggcaaaacatcccgccgattgccaatccgttc
aagcccgatgcgctgccggaagcctacatcgcgaacgcggccaccgacgacgagcgctat
tacgttccgttcaccgaaacggtttcgtcgcggccgctgtggatctcgccgtcgcagaac
aaatggtgcgacatcctgatggcgaaggaagcggggctcgtgaaccggcactatcacccg
cacgaggtgttcgcttacaccctgtccggcaaatggggctacctggaacacgaatggacc
gcgacgaaaggcgatttcgtgtacgagacgccgggcgaaggccacacgctcgtcgcgttc
gatcaccccgagccgatgcgcgcgttcttcatcgtcaaggggccgctgatctggctcgac
gaagaaggcaaccccgacggctatttcgacgtgcattcgtacatcgcgatgtgcaaggcg
cattacgagaaggtcggcctcggcgcgcaggcgatcgagaagctgttccgctga

DBGET integrated database retrieval system