KEGG   Burkholderia pyrrocinia: ABD05_21210Help
Entry
ABD05_21210       CDS       T03962                                 

Definition
(GenBank) 2-deoxy-D-gluconate 3-dehydrogenase
Organism
bpyr  Burkholderia pyrrocinia
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase Glyco_trans_4_4 KR RmlD_sub_bind Glyco_transf_4 Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: AKM02721
UniProt: A0A0G3WY25
LinkDB All DBs
Position
2:1100005..1100727
Genome map
AA seq 240 aa AA seqDB search
MSRSWAFEGKTVVVTGGTSGIGASTAWRFAEAGASVVALGLDVAGPHAPVHPRVRCMELN
VTDSDALTRTIAALPRLDVLVNGVGISRHADEYRMDQFELVLNVNLTSVMRASDAALPAL
SAHGGSIVNVASMYTYFGSKDRPAYSASKGGIAQLTRSLAQAWAERGIRVNAVAPGWIDT
PLSSGLMADAHASRQILDRTPLGRWGTADEVANVILFLCSPGASFVTGAIVPVDGGYSTV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgttcgtgggcgtttgaaggcaagaccgtcgtcgtgacgggcggcacgtcgggc
atcggcgcgagcaccgcctggcgcttcgcggaagcgggcgcgtcggtcgtcgcgctcggg
ctcgacgtcgccggcccgcatgcgccggtgcatccgcgcgtccggtgcatggagctgaac
gtgaccgacagcgacgcgctgacgcgcacgatcgccgcgttgccgcggctcgacgtgctc
gtcaacggcgtcggcatcagccggcacgcggacgaataccggatggaccagttcgagctc
gtgctgaacgtgaacctgacgtcggtgatgcgcgcgtccgacgccgcgttgccggcgctg
tcggcccacggcggcagtatcgtcaacgtcgcgtcgatgtacacgtacttcggcagcaag
gaccggcccgcgtacagcgcgagcaagggcggtatcgcgcagctcacgcgttcgctcgcg
caggcgtgggccgagcgcggcatccgcgtgaacgcggtcgcgcccggctggatcgacacg
ccgctcagcagcgggctgatggccgacgcgcacgcgtcgcggcagatcctcgatcgcacc
ccgctcgggcgctggggcaccgccgacgaggtcgcgaacgtgatcctgttcctgtgctcg
cccggcgcgtcgttcgtgaccggcgcgatcgtgccggtggacggcgggtattcgacggtc
tag

DBGET integrated database retrieval system