KEGG   Brevundimonas sp. SGAir0440: E7T10_10525Help
Entry
E7T10_10525       CDS       T06410                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
brev  Brevundimonas sp. SGAir0440
Brite
KEGG Orthology (KO) [BR:brev00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E7T10_10525 (ahpF)
Enzymes [BR:brev01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     E7T10_10525 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 FAD_binding_3 NAD_binding_7 AlaDh_PNT_C Glutaredoxin NAD_binding_8 Thi4 HI0933_like FMO-like DAO K_oxygenase
Motif
Other DBs
NCBI-ProteinID: QCQ99072
UniProt: A0A4P8QD68
LinkDB All DBs
Position
complement(2124375..2125964)
Genome map
AA seq 529 aa AA seqDB search
MLDANLKSQLEAYLKNIVHPVELVASLGAGPKSIELKTLLEEIVSVSHGKVEMGRDYDDE
RQPSFLIRRKGTDIGVRFAGIPLGHEFTSLVLALLHVGGHPSKAAQEVIQQVRDLDGDYV
FETYFSLSCQNCPDVVQALNLMSVINPRIKHVAIEGGLFKDEVEERKIMAVPTVFLNGEL
FGQGRMELEQIVAKLDSGSEARAAERLKSKDPFEVLVVGGGPAGAAAAIYTARKGIRTGV
VAERFGGQVLDTMAIENFVSVPYTEGPKLAAHLEQHVREYDVDLMNLQKAAKLIPAKVPG
GLHEVVLENGASLKSRTIILSTGARWRQMNVPGEEQYKNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVAHVTLIEYDSELRADAVLQRKLATLPNVRIVTSALTTQVHGD
GEKVTGLSYKDRNSDAHHDVDLEGIFVQIGLVPNTEWLHGAVGLTPRGEIEVDHRGETSQ
PGVFAAGDATTVPYKQIVIAMGEGSKAGLSAFDYMIRTEPAKEAVAEPA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctagacgccaacctgaaatcccagctcgaagcctacctcaagaacatcgtccatccc
gtcgaactggtcgcctcgctgggtgcggggcccaagtcgatcgagctgaaaactctgctg
gaggagatcgtctcggtctcgcacggcaaggtggagatgggccgcgactatgatgacgaa
cgccagcccagcttcctgatccgcaggaagggcacggacatcggcgtgcgattcgcgggc
attccgctgggccacgagttcacctcgctggtgctggccctgctgcacgttggcggccat
ccgtccaaggcggcgcaggaggtgatccagcaggtcagggacctggacggcgactatgtg
ttcgagacctatttctcgctgtcgtgccagaactgcccggacgtggtgcaggcgctgaac
ctgatgagcgtgatcaatccgcgcatcaaacacgtcgccatcgaaggcggcctgttcaag
gacgaggtcgaagaacgcaagatcatggccgtgccgacggtcttcctgaacggcgaactg
ttcggtcagggccggatggagctggagcagatcgtcgccaagctggattccggctccgaa
gcccgcgcggccgagcgtctgaagtcgaaggatccgttcgaggttctggtggtcggcggc
gggccggccggggcggcggcggcgatctatacggcgcgcaagggcattcgcacgggcgtg
gtcgccgaacgcttcggcggtcaggtgctggacacgatggcgatcgagaacttcgtctcg
gtcccctacaccgagggacccaagctggcggcccatctggagcagcacgtccgcgagtat
gacgtggacctgatgaacctgcagaaggcggccaagctgatcccggccaaggttccaggc
ggcctacacgaggtggtgctggagaacggcgcatcgctgaaatcgcgcaccatcatcctg
tcgaccggcgcgcgctggcgccagatgaacgtgccgggcgaagagcagtacaaaaacaag
ggcgtggcctattgcccgcactgcgacggaccgctgttcaagggcaagcgggtggcggtg
atcggcggcggcaactcgggcgtcgaggcggcgatcgacctggcgggcatcgtcgcccat
gtgaccctgatcgaatacgacagcgagctgcgggccgatgcggtgctgcagcgcaagctg
gcgaccctgccgaacgtgcggatcgtgacctcggccctgacgacccaggtgcatggcgac
ggcgagaaggtgacagggctgtcctacaaggaccgcaactctgacgcccatcacgacgtc
gatctggaaggcatcttcgtgcagatcggtctggtgccgaacaccgaatggctgcacggc
gcggtgggcctgaccccgcgcggcgagatcgaggtggatcaccgcggcgagacctcgcag
ccgggcgtctttgcggcgggcgacgcgacgaccgtgccctacaagcagatcgtcatcgcc
atgggcgaggggtccaaggcgggtctgtcggccttcgactacatgatccgcaccgagccg
gcgaaagaggccgtggccgaaccggcttga

DBGET integrated database retrieval system