KEGG   Bradyrhizobium sp. SK17: CWS35_14470Help
Entry
CWS35_14470       CDS       T05325                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:brk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CWS35_14470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:brk02000]
    CWS35_14470
Enzymes [BR:brk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CWS35_14470
Transporters [BR:brk02000]
 Other Transporters
  Pores ion channels [TC:1]
   CWS35_14470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: AUC95312
UniProt: A0A2K8YCC4
LinkDB All DBs
Position
3107507..3108127
Genome map
AA seq 206 aa AA seqDB search
MLKLYTAPGTCALASHIALAEAGAPYTVERLDFKNNQQNSPEYLKINPKGRVPTLVTEHG
VLTETPAMLAYIAQTYPQAKLAPLDDAFAFARLQSFNSYLCSTVHVCHAHKMRGARWATQ
ESSFADMKTMIPKTMGACFNLIERDMLRGPWVMGENYTVGDAYLYTLTLWLDGDGVDIAT
LPKVKAHRTAMESRPAVQKVLAEQRA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagctctacaccgcccccggcacctgtgcgctcgcctcccacatcgcgctggcc
gaagccggcgcgccctacacggtcgagcggctcgacttcaagaacaaccagcagaacagc
ccggaatatctcaagatcaatccgaagggccgggtgccgacgctggtgaccgagcacggc
gtgctgaccgagacgccggcgatgctggcctatatcgcgcagacctatccgcaggcgaag
ctcgcgccgctcgacgacgccttcgcattcgcccggctacagtcgttcaactcctatctc
tgctcgacggtgcatgtctgccacgcccacaagatgcgcggcgcgcgctgggcgacccag
gagagctcgttcgccgacatgaagacgatgatcccgaagaccatgggcgcctgcttcaac
ctgatcgagcgcgacatgctcaggggaccgtgggtgatgggcgagaactacaccgtcggc
gatgcctatctctacacgctcaccctctggctcgacggcgacggtgtcgacatcgcgacc
ttgcccaaggtcaaggcgcaccgcacggcgatggagagccgcccggcggtgcagaaggtg
ctggcggagcagagggcgtaa

DBGET integrated database retrieval system