Brassica rapa (field mustard): 103841836 Help Entry 103841836         CDS       T03449                                  Name (RefSeq) SKP1-like protein 13   KO K03094   S-phase kinase-associated protein 1 Organism brp  Brassica rapa (field mustard) Pathway brp03083   Polycomb repressive complex brp04120   Ubiquitin mediated proteolysis brp04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:brp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103841836    04120 Ubiquitin mediated proteolysis     103841836   09126 Chromosome    03083 Polycomb repressive complex     103841836  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:brp04131]     103841836    04121 Ubiquitin system [BR:brp04121]     103841836    03036 Chromosome and associated proteins [BR:brp03036]     103841836 Membrane trafficking [BR:brp04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     103841836 Ubiquitin system [BR:brp04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      103841836    Cul7 complex      103841836 Chromosome and associated proteins [BR:brp03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      103841836   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      103841836 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Herpesvir_UL11 Motif Other DBs NCBI-GeneID:  103841836 NCBI-ProteinID:  XP_009116659 UniProt:  M4CTE3 LinkDB All DBs Position A09:37046766..37047483 Genome browser AA seq 158 aa AA seqDB search MSKEMFTLKSSDGFLFVVDEAVVHQSVTLSPMVQDCAGREYPINNVTGKILNLVVEYCKN HVVVDGGDSSSSSSSGDALKKWDDKFITQMDLSTVYDLIMAANYLIIKGLFDLACQRVAD VIAACKDHEEIRATLGIVSDYTAEEEAEVLKENEWAFD NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atgtcgaaggagatgttcacgttgaagagctccgacggtttcttatttgtggttgacgaa gcggtcgtacatcaatcagtgacactgtcgcctatggttcaagattgcgccggtcgtgaa tacccgatcaacaacgtcacaggcaaaatcctcaacttagtggtagaatactgcaagaat cacgtcgttgtcgacggtggcgattcttcttcctcctcctcctccggcgatgctctcaag aagtgggacgataagttcatcacgcaaatggatctgtcgacggtctacgatctcatcatg gctgcgaactacctaatcatcaaaggtctttttgatctcgcttgccagagagtcgctgac gtgatcgcagcatgcaaagaccatgaggagattcgcgcaacgttgggcatcgtgagtgac tacacagcagaggaggaagcagaggttctcaaggagaacgagtgggcttttgattga

DBGET integrated database retrieval system