KEGG   Bacillus safensis: BSL056_01460
Entry
BSL056_01460      CDS       T05386                                 

Definition
(GenBank) glutathione-dependent formaldehyde dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
bsaf  Bacillus safensis
Pathway
bsaf00010  Glycolysis / Gluconeogenesis
bsaf00071  Fatty acid degradation
bsaf00350  Tyrosine metabolism
bsaf00625  Chloroalkane and chloroalkene degradation
bsaf00626  Naphthalene degradation
bsaf00680  Methane metabolism
bsaf01100  Metabolic pathways
bsaf01110  Biosynthesis of secondary metabolites
bsaf01120  Microbial metabolism in diverse environments
bsaf01200  Carbon metabolism
bsaf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bsaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSL056_01460
  09102 Energy metabolism
   00680 Methane metabolism
    BSL056_01460
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSL056_01460
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BSL056_01460
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSL056_01460
   00626 Naphthalene degradation
    BSL056_01460
Enzymes [BR:bsaf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BSL056_01460
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     BSL056_01460
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 FtsJ Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: APJ09709
LinkDB
Position
260753..261886
AA seq 377 aa
MRAVTYQGKNSIAVKKVDAPWIQDREDVIIRITSTAICGSDLHLYQGNFPLPIGYVIGHE
PMGIVEEVGPDVTAVKKGDRVVIPFTVACGKCQYCDHHLESQCDNSNPHYDSGGLFGYSE
KYGNYPGGQAEYLRVPFGNYTPFKIPEDCELEDEQLLFLSDVLPTAYWSVEHAGVKKGDT
VIVLGCGPVGLMAQQFAWQKGAERVIAVDYIDYRLRHAKRMSGVEVFDFTEDPDMGETLK
ELTKGGADVVIDCVGMDGKKSPLEKIEQKLKLQGGTIGPIQIATKAVRKCGTVQMTGVYG
GLYNMFPLGAFFARNVTLKMGQAPARGYMSKLYQKVTSGEIDPRAIITHKLPLDEAAHAY
HIFNDKQDDCIKVVLKP
NT seq 1134 nt   +upstreamnt  +downstreamnt
gtgagagctgttacttatcaagggaaaaatagcattgcagtgaagaaagtagatgcaccg
tggattcaagatcgggaagatgtgatcatacgtattacatcaacagcaatttgtggatca
gatttacatttgtatcaggggaatttcccgcttccaatcggctatgtgattgggcatgaa
ccaatggggattgtggaggaagttggcccggatgtcacagccgtaaaaaagggagaccgt
gtcgtcattccatttacagttgcatgtggtaaatgccaatattgcgatcatcacttagaa
agccaatgtgacaactcaaacccgcactacgattcgggtggactttttggctatagtgag
aaatatgggaattaccccggaggacaggcagagtatttacgcgtaccttttggcaactat
acaccgtttaagatcccagaagattgtgagctggaggatgaacaattgctgttcttatca
gatgtcctgccaaccgcctattggagtgtagagcacgcaggtgtgaaaaaaggcgatacg
gtcatcgtgctaggctgcggacctgttgggttaatggcacagcaatttgcttggcaaaaa
ggagcagaacgtgtgattgccgtcgattacattgattaccgcctacggcatgcaaaacga
atgagcggcgttgaggtctttgactttacagaagatcccgacatgggagaaacgttaaag
gagctcaccaagggcggggccgatgttgtgattgattgtgtgggaatggacgggaagaag
tcgccgcttgaaaaaattgagcaaaagctcaagctgcaaggcggaacgatcggacccatt
caaattgccacaaaagccgttcgcaaatgtggaacagtgcagatgacgggtgtgtacggc
ggcctgtacaacatgtttccattaggcgcttttttcgcaagaaacgtcaccctgaaaatg
ggccaagccccggcgagaggatacatgtcaaagctctatcaaaaagtgacaagcggtgaa
attgatcctagagccattatcactcacaaattaccattagatgaagctgcacatgcgtac
cacatcttcaatgacaaacaggatgattgtataaaggtcgttttaaagccataa

DBGET integrated database retrieval system