KEGG   Blastococcus saxobsidens: BLASA_1405Help
Entry
BLASA_1405        CDS       T01752                                 

Gene name
mpdB
Definition
(GenBank) 2-methyl 1,2 propanediol dehydrogenase
  KO
K20927  2-methyl-1,2-propanediol dehydrogenase [EC:1.1.1.400]
Organism
bsd  Blastococcus saxobsidens
Brite
KEGG Orthology (KO) [BR:bsd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BLASA_1405 (mpdB)
Enzymes [BR:bsd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.400  2-methyl-1,2-propanediol dehydrogenase
     BLASA_1405 (mpdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N FAD_binding_2 FAD_binding_3 Pyr_redox_2 DAO Lycopene_cycl Fer4_2 NAD_binding_8 Fer4_9 Thi4 Fer4_7 Pyr_redox_3 Fer4_6
Motif
Other DBs
NCBI-ProteinID: CCG02338
UniProt: H6RJN3
LinkDB All DBs
Position
1343028..1344689
Genome map
AA seq 553 aa AA seqDB search
MASYSEADVLVIGAGAGGAAVSKRLSDAGITVICLEQGDWVHPLQHPHFHSEWEIEKRRG
WSHDPNVRQLPEDYPTTGNTPPLMYNAVGGSAIIYAGAWPRFKPVDFRRGTEHGVEGTID
WPISYEDLEPFYAINDAEVGVARRPGDPGNPARLPGWGPAIPPGKVGNRLARAFDTLGWH
WWPADHSILTRPKDNRLACNACGPCLAGCPRHSIATPDVTYWPKALSNGVDLRTNARVER
INVDKGRATGATYIDRRTGQRSEVRAKIVVLCANGVGTPRLLLMSAQAGHPDGLANSSGL
VGTHLMFHAWAFEDFWFDEPIEGYKAQEAAVLYSQEFYNSDPDRGFVNGFSIQVGRSSGA
AHSALGANSGNLAPWGAGHREFFNTHFGSHLLVYIQGEDLPIATNRVTLDSTVTDSSGLP
AAHVNYELHENDRRLLAYGRERAREAAAVAGGLIDTSSSGSGGYDFPQPGWHLMGTARMG
NTPEDSVTNKFNQTWDVPNLFIADGSSLPTSAAVNPTSTLQAVAVRCAEYIKDNHAEILG
QKTTPRNHELPAG
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctacagcgaggccgacgtcctggtcatcggggccggcgcaggcggtgcggcg
gtgagcaagcggctcagcgacgccggcatcacggtgatctgcctggagcagggtgactgg
gtacacccgctgcagcacccgcacttccactcggaatgggagatcgagaagcggcgcggg
tggtcacacgacccgaacgtgcgccagctccccgaggactacccgaccacgggcaacacc
ccaccgctgatgtacaacgcggtcggcggctcggcgatcatctacgccggagcttggccg
cggttcaagccggtcgacttccggcgcggcaccgagcacggcgtcgagggaacgatcgac
tggccgatcagctacgaggacctcgagccgttctacgccatcaacgacgccgaggtgggc
gtggctcgccgaccgggtgacccgggcaacccggcccggctgcccggctggggcccggcc
atcccgccgggcaaggtgggcaaccgcctggcgcgcgcgttcgacacccttggctggcac
tggtggccggccgaccactcgatcctgacccgacccaaggacaaccggctggcctgcaac
gcctgcggcccctgcctggctggctgccctcgccactccatcgccaccccggacgtcacg
tactggcccaaggcactgagcaacggtgtcgacctgcgcaccaacgcacgtgtggagcgc
atcaacgtggataaagggcgtgcgacgggggccacgtacatcgaccgccgcaccggccaa
cgctccgaggtgcgagccaagatcgtggtgctgtgcgccaacggcgtcggcacgccgcgg
ctgctgctgatgtcggcgcaggccggtcacccggacgggctggccaactccagcggcctc
gtaggaacacatctgatgttccacgcctgggccttcgaagacttctggttcgacgaaccc
atcgaaggctacaaggcccaggaggctgcggtcctgtacagccaggagttctacaacagc
gatcccgaccgcggcttcgtcaacgggttctccatccaggtcgggcgctcctccggggct
gcgcacagcgcgctcggcgccaacagcggaaacctggccccttggggcgcaggccaccgt
gagttcttcaacacccacttcggcagtcatctcctggtctacatccagggggaggacctg
ccgatcgcgaccaaccgggtgaccctggactcgacggtcaccgactccagcggcctgccc
gcggcgcacgtcaactacgagctccacgagaacgaccggcggctgctcgcgtacggccgc
gaacgggcgcgggaggcggcggctgtcgccggagggctcatcgacacctcgagcagcggc
agtggcggctacgacttcccgcaaccgggctggcacctgatggggaccgcgcggatgggc
aacacacccgaggactcggtgaccaacaagttcaaccagacctgggacgtcccgaacctg
ttcatcgccgacggcagctcgctgcccaccagcgccgccgtcaacccgacaagcacgctg
caggcggtcgccgtccggtgcgcggagtacatcaaggacaaccacgccgagatcctcggc
cagaagaccacgccccggaaccatgaactcccggccggctga

DBGET integrated database retrieval system