KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_20100
Entry
BSU6051_20100     CDS       T02503                                 
Symbol
yosJ
Name
(GenBank) phage SPbeta
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
SSDB
Motif
Pfam: DUF4371 DUF982
Other DBs
NCBI-ProteinID: AGG61398
LinkDB
Position
complement(2166657..2166851)
AA seq 64 aa
MIQGFYKDQKLHLLEDPMQQYTVMKVEENAVCVYRWIDDYRHKIERFTDVEEAKKLLGEG
WPKQ
NT seq 195 nt   +upstreamnt  +downstreamnt
atgattcaagggttttataaagatcagaaacttcatcttctagaagatcctatgcagcag
tacaccgtcatgaaagttgaagaaaatgcagtatgtgtttaccggtggatcgatgattat
agacacaagattgaaagattcacagatgttgaagaggctaaaaaactccttggagaaggg
tggccgaaacaatag

DBGET integrated database retrieval system