KEGG   Bacillus subtilis PY79: U712_11685Help
Entry
U712_11685        CDS       T02937                                 

Definition
(GenBank) Arginine-binding extracellular protein ArtP
  KO
K23059  arginine/lysine/histidine transporter system substrate-binding protein
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    U712_11685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsp02000]
    U712_11685
Transporters [BR:bsp02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Arginine/lysine/histidine transporter
    U712_11685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 NMT1 Phosphonate-bd Lig_chan-Glu_bd OpuAC Phage_TAC_5 NMT1_3 SBP_bac_5 DUF4969 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AHA78278
LinkDB All DBs
Position
complement(2309895..2310662)
Genome map
AA seq 255 aa AA seqDB search
MKKWLLLLVAACITFALTACGSSNSGSESGKKKLIMGTSADYKPFEYKEGDNIVGFDVEL
AKALAKKAGYEIEVQDMDFNSLITALKSKQVDLVLSGMTPTPERKKQVDFSDVYYTANHM
IVSKKDSGIQSLKDLKGKTVGVQLGSIQEEKGKELSPEYGFKTEDRNRISDLVQEIKSDR
FDAAIIEDIVAEGYFKSNDDLQGFVIPDAKAEEAGSAIAFRKDSELTDKFNKALKEMEDN
GELEKLKKKWFTGEK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatggctcttattacttgtggctgcttgcatcacctttgcattaactgcgtgc
ggctcaagcaattcaggttcagaaagcggaaagaaaaaattaattatgggtacttcggcg
gattacaaaccgtttgaatataaagaaggagataatattgtcggctttgatgtagagctg
gcaaaagctctggcaaagaaggcaggctatgaaattgaagtgcaggatatggacttcaac
agcttaattacagcgcttaaatcaaaacaggtggatctcgttctgtcaggaatgacacca
acgcctgagcgtaaaaaacaagttgatttttccgatgtgtattacacagcgaaccatatg
attgtcagcaaaaaagacagcggcattcaatctttgaaagacctgaaaggaaaaacagtt
ggcgttcagcttggctctattcaggaagagaaggggaaagagctttctccggaatatggt
tttaaaacagaagaccgcaacagaatttctgatttggtgcaggaaatcaaatctgaccgc
ttcgatgccgcgattattgaagacattgttgcagaagggtatttcaaatcaaatgatgac
ctgcaaggctttgtgattcctgatgcgaaagcggaagaagccggttcagcaattgctttc
agaaaggacagtgaactgacagacaaattcaataaagcgctcaaggaaatggaagataac
ggagagcttgagaaattgaagaaaaaatggttcactggcgagaagtaa

DBGET integrated database retrieval system