KEGG   Burkholderia stabilis: BBJ41_08980
Entry
BBJ41_08980       CDS       T04946                                 

Definition
(GenBank) leucine--tRNA ligase
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
bstl  Burkholderia stabilis
Pathway
bstl00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BBJ41_08980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bstl01007]
    BBJ41_08980
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bstl03016]
    BBJ41_08980
   03029 Mitochondrial biogenesis [BR:bstl03029]
    BBJ41_08980
Enzymes [BR:bstl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     BBJ41_08980
Amino acid related enzymes [BR:bstl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BBJ41_08980
Transfer RNA biogenesis [BR:bstl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BBJ41_08980
 Prokaryotic type
    BBJ41_08980
Mitochondrial biogenesis [BR:bstl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BBJ41_08980
SSDB
Motif
Pfam: tRNA-synt_1_2 tRNA-synt_1 tRNA-synt_1g Anticodon_1 tRNA-synt_1e
Other DBs
NCBI-ProteinID: AOR67669
UniProt: A0A1D7ZCP1
LinkDB
Position
1:complement(1934283..1936877)
AA seq 864 aa
MHERYVPADVEAAAQGDWRAADAYKTKEDSQKPKFYCVSMLPYPSGKLHMGHVRNYTIND
VMYRYLRMNGYNTLMPMGWDAFGMPAENAAMANGVPPAKWTYDNIDYMKGQMQSMGLAID
WSREIATCKPDYYKWNQWLFLKMLEKGIAYKKTGTVNWDPVDQTVLANEQVNDGRGWRSG
ALVEKREIPMYYLRITQYADELLNDLEGLGWPERVKIMQQNWIGKSFGVNFGFPYELDGE
KKLLRVFTTRADTIMGVTFCAIAAEHPLATRLAQDKPELLAFIDECKRGGVAEADVATME
KKGVATGFSVAHPLTGEPVEVWIGNYVLMSYGEGAVMGVPGHDERDFAFAKKYDLPIKQV
IAAEGQAYSLDAWQEWYGDKETAVCVSSGKYDGLRYADAIDAVAADLNAGGFGDKQVTWR
LRDWGVSRQRYWGTPIPIIHCPSCGDVPVPEKDLPVVLPEDLVPDGSGNPLAKSEAFLNC
ACPKCGAAAKRETDTMDTFVDSSWYFSRYTAPDADTMVDARTDYWMPMDQYIGGIEHAIL
HLLYSRFWTKVMRDLGLVKFGEPAKNLLTQGMVLNETFYREDASGKKTWYNPADVTVTFD
DKGRPVGATLNADGQPVVLGGIEKMSKSKNNGVDPQVLIDLYGADTARLFTMFAAPPEQQ
LEWSGAGVEGASRFLRRVWSFGYANREALVARAGFDAAALGEADKALRREIYSVLKQADF
DYQRLQYNTVVSAAMKMLNAIDGAKGATPGVLREAYGVLLRVLYPVVPHVTFELWKALGY
ADEFGPLLDAPWPKVDEAALEQAEIELVLQVNGKVRGALKVAKDASREAIEAAAVADDAF
AKFSDGKPAKKIVVVPGRLVNIVV
NT seq 2595 nt   +upstreamnt  +downstreamnt
atgcacgagagatacgtacccgccgacgtcgaagccgccgcccagggcgactggcgcgca
gccgatgcctacaagacgaaggaagattcgcagaagccgaagttctactgcgtgtcgatg
ctgccgtacccgtccggcaagctgcacatgggtcacgtgcgcaactacacgatcaacgac
gtgatgtaccgctatctgcggatgaacggctacaacacgctgatgccgatgggctgggac
gcgttcgggatgccggccgagaacgccgcgatggcgaacggagtgccgcccgcgaagtgg
acctacgacaacatcgactacatgaagggccagatgcagtcgatgggcctcgcgatcgac
tggtcgcgcgaaatcgcgacgtgcaagcccgactactacaagtggaaccagtggctgttc
ctgaagatgctcgagaagggcatcgcgtacaagaagacgggcaccgtgaactgggacccg
gtcgaccagaccgtgctcgcgaacgagcaggtgaacgacggccgcggctggcggtcgggc
gcgctcgtcgagaagcgcgagatcccgatgtactacctgcggatcacgcagtacgccgat
gagctgctgaacgacctcgaaggcctcggctggcccgagcgcgtgaagatcatgcagcag
aactggatcggcaagagcttcggcgtgaacttcggcttcccgtacgaactcgacggcgag
aagaagctgctgcgcgtgtttacgacgcgcgccgacacgatcatgggcgtcacgttctgc
gcgatcgcggccgagcatccgctcgccacgcgcctcgcgcaggacaagcccgagctgctg
gcgttcatcgacgaatgcaagcgcggcggtgtcgccgaggccgacgtcgcgacgatggag
aagaagggcgtcgcgacgggcttctcggtcgcgcacccgctgaccggcgaacccgtcgag
gtgtggatcggcaattacgtgctgatgagctatggcgaaggtgcggtgatgggcgtgccg
ggccacgacgagcgcgatttcgcgttcgcgaagaagtacgacctgcccatcaagcaagtg
atcgcggccgaaggccaggcgtactcgctcgatgcctggcaggagtggtacggcgacaag
gaaaccgccgtctgcgtgagcagcggcaagtacgacggcctgcgctatgcggacgctatc
gacgcggtcgccgccgacctgaacgccggcggcttcggcgacaagcaggtcacgtggcgc
ctgcgcgactggggcgtgtcgcgccagcgctactggggcacgccgatcccgatcatccac
tgcccgtcgtgcggcgacgtgccggtgccggagaaggatctgcccgtcgtgctgccggaa
gacctcgtgccggacggctcgggcaacccgctcgcgaagtcggaagcgttcctgaactgc
gcatgcccgaagtgcggcgcggccgcgaagcgcgaaaccgacacgatggataccttcgtc
gattcgtcgtggtacttctcgcgctacacggcgccggacgccgacacgatggtcgacgcg
cgcaccgactactggatgccgatggatcaatacatcggcggcatcgagcacgcgatcctg
cacctgctgtattcgcgtttctggaccaaggtgatgcgcgacctcggtctcgtgaagttc
ggcgagccggcgaagaacctgctcacgcaggggatggtgctgaacgagacgttctaccgc
gaagacgcatcgggcaagaagacctggtacaacccggccgacgtgaccgtcacgttcgac
gacaaggggcgcccggtcggtgcgacgctgaacgccgacggccagccggtcgtgctcggc
ggcatcgagaagatgtcgaagtcgaagaacaacggtgtcgatccgcaggtgctgatcgac
ctgtacggcgcggataccgcgcgcctgttcacgatgttcgccgcgccgcccgagcagcag
ctcgagtggtcgggtgcgggcgtcgagggcgcgagccgcttcctgcgccgcgtgtggagc
tttggctacgcgaaccgcgaagcgcttgtcgcgcgcgcgggcttcgacgcggctgcgctc
ggcgaagccgacaaggcgctgcgccgcgagatctacagcgtgctgaagcaggccgatttc
gattaccagcgcctgcagtacaacacggtcgtgtcggccgcgatgaagatgctgaatgcg
atcgacggtgcgaagggcgcgacgcccggcgtgctgcgcgaagcgtacggcgtgctgctg
cgcgtgctgtacccggtcgtgccgcacgtcacgttcgagttgtggaaggcgctcggctac
gccgacgaattcggcccgctgctcgatgcgccgtggccgaaggtcgacgaggccgcgctc
gagcaggccgagatcgaactcgtgctgcaggtgaacggcaaggtgcgcggcgcgctgaag
gtcgcgaaggacgcgagccgcgaggcgatcgaagccgcggcggtggccgacgacgcattc
gcgaagttcagcgacggcaagccggcgaagaagatcgtcgtcgtgccgggccgtctcgtg
aacatcgtcgtctga

DBGET integrated database retrieval system