KEGG   Burkholderia stabilis: BBJ41_19045Help
Entry
BBJ41_19045       CDS       T04946                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bstl  Burkholderia stabilis
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BBJ41_19045
Enzymes [BR:bstl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BBJ41_19045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_binding_3 Glutaredoxin HI0933_like DAO K_oxygenase FAD_oxidored Thi4 Ribosomal_S9 NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AOR69717
UniProt: A0A1D7ZIM0
LinkDB All DBs
Position
2:complement(207603..209201)
Genome map
AA seq 532 aa AA seqDB search
MLDANLKNQLKAYLEKISRPIELVASLDDSAKSQELLALLNEIASLTDRVTVTERRDDAE
RKPSFSIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDYA
FETYFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQDEVESRQIMAVPTMFLNGAS
FGQGRSSVKEILAKLDTGASARAAKSLETRPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRADALIPGDVHQ
IRLANGAVLKAKTIILATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKAVTLIEYGAQLRADEVLQRKLRSLPNVTIVTQAQTTELTGDGSKL
NGLVYKDLRSGETKRVELEGVFVQIGLVPNTEWLKGTIELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDYMIRQDATPATAAQPQAEEAVAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaaccaactcaaagcgtacctcgaaaaaatctcgcgcccg
atcgaactcgtcgcctcgctcgacgacagcgcgaaatcgcaggaactgctggcgctgctg
aacgagattgcgtcgctgacggatcgcgtgaccgtcaccgaacgccgcgacgacgccgag
cgcaagccgtcgttctcgatcggcgagcccggcaagccggccggcatccgcttcgccggc
atcccgatgggccatgaattcacgtcgctcgtgctcgcgctgctgcaaaccggcggccac
ccgatcaagctcgacgacgacgtgatcgaacagatccgcgcgctcgatggcgattacgcg
ttcgagacgtacttctcgctgtcctgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgctgatcaacccgcgcatccgtcacgtcgcgatcgacggcgcattgttccag
gatgaagtcgagtcgcgccagatcatggccgtgccgacgatgttcctgaacggcgcgtcg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgatacgggtgccagc
gcgcgcgctgcgaagtcgctcgaaaccaggcccgtgttcgacacgctgatcgtcggcggc
ggcccggcaggcgcggccgcggcaatctactcggcgcgcaagggcatcgcgacgggcgtc
gtcgccgagcgtttcggcggccaggtgctcgacacgatggccatcgagaacttcgtgtcg
gtgcaggaaaccgaagggccgaagttcgccaccgcgctcgagcaacacgtgaagcagtac
gacgtcgacatcatggacgtgcagcgcgccgacgcgctgattccgggcgacgtgcaccag
atccgcctcgcgaacggcgcggtgctgaaggcgaagacgatcattctcgcgaccggcgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgaataccgcaatcgcggtgtcgcctac
tgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtggtcggcggcggc
aactcgggcgtcgaggccgcgatcgatctcgccggcatcgtgaaggcagtcacgctgatc
gaatacggcgcacaactgcgtgcggacgaagtgctgcagcgcaagctgcgcagcctgccg
aacgtgacgatcgtcacgcaggcgcaaacgaccgagctgaccggcgacggcagcaagctg
aacgggctcgtgtacaaggatctgcgttcgggcgaaacgaagcgcgtcgagctcgaaggc
gtgttcgtgcagatcggcctcgtaccgaacaccgaatggctgaaaggcacgatcgaactg
tcgaagcacggcgagatcgtcgtcgatgcgcgcggcgcgacgtcggtgcccggcgtgttc
gcggccggcgacgtgacgacggtgccgttcaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcatcgctcggcgcattcgactacatgatccgccaggatgcgacgccggccacc
gctgcgcagccgcaagccgaggaagcggtcgccgcgtaa

DBGET integrated database retrieval system