KEGG   Bacillus subtilis subsp. subtilis 168: BSU00240
Entry
BSU00240          CDS       T00010                                 
Symbol
csfB
Name
(RefSeq) sporulation protein CsfB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Gin
Other DBs
NCBI-GeneID: 937016
NCBI-ProteinID: NP_387905
Pasteur: BG10088
UniProt: P37534 A0A6M4JE36
Structure
LinkDB
Position
35531..35725
AA seq 64 aa
MDETVKLNHTCVICDQEKNRGIHLYTKFICLDCERKVISTSTSDPDYAFYVKKLKSIHTP
PLYS
NT seq 195 nt   +upstreamnt  +downstreamnt
atggacgaaacagttaaacttaatcatacatgtgtgatttgtgatcaagagaagaataga
ggcattcatctttatacgaaattcatatgcttagattgtgagagaaaagtaatttctaca
tcaacttctgatcctgactatgcgttttacgtaaaaaaactaaagagcattcatacaccg
ccattatattcatag

DBGET integrated database retrieval system