KEGG   Bacillus subtilis subsp. subtilis 168: BSU01670
Entry
BSU01670          CDS       T00010                                 
Symbol
ybbE
Name
(RefSeq) hypothetical protein
  KO
K21469  serine-type D-Ala-D-Ala carboxypeptidase [EC:3.4.16.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00550  Peptidoglycan biosynthesis
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU01670 (ybbE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU01670 (ybbE)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU01670 (ybbE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BSU01670 (ybbE)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   BSU01670 (ybbE)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BSU01670 (ybbE)
SSDB
Motif
Pfam: Beta-lactamase DnaJ-like_C11_C
Other DBs
NCBI-GeneID: 938886
NCBI-ProteinID: NP_388048
Pasteur: BG11566
BSORF: BG11566
UniProt: O05213 A0A6M3ZC08
LinkDB
Position
complement(188408..189733)
AA seq 441 aa
MKTKTLFIFSAILTLSIFAPNETFAQTAGNLIEPKIINAETAQFSTKKLRKVDQMIERDI
AAGFPGAVLVVVKDGRIIKKAAYGYSKKYEGSELLRRPAKMKTRTMFDLASNTKMYATNF
ALQRLVSQGKLDVYEKVSAYLPGFKDQPGDLIKGKDKIRVIDVLQHQSGLPSSFYFYTPE
KAGKYYSQERDKTIEYLTKIPLDYQTGTKHVYSDIGYMLLGCIVEKLTGKPLDVYTEQEL
YKPLRLKHTLYNPLQKGFKPKQFAATERMGNTRDGVIQFPNIRTNTLQGEVHDEKAFYSM
DGVSGHAGLFSNADDMAILLQVMLNKGSYRNISLFDQKTADLFTAPSATDPTFALGWRRN
GSKSMEWMFGPHASENAYGHTGWTGTVTIIDPAYNLGIALLTNKKHTPVIDPEENPNVFE
GDQFPTGSYGSVITAIYEAME
NT seq 1326 nt   +upstreamnt  +downstreamnt
gtgaaaacaaagacactgttcatattcagtgccattttaaccctatcgatatttgcgcca
aatgaaaccttcgcacaaacagcaggcaacttgattgagccgaaaatcataaatgcagaa
actgcacaattctcgacgaagaagctaaggaaggtagatcagatgatagaacgggatatt
gcagcaggatttccaggcgccgttcttgtggtggtgaaggatggacgcatcataaaaaaa
gcagcatacggctacagtaaaaagtacgaaggatcagaactgctgcgccgtccggccaaa
atgaaaacccgcacgatgtttgacttagcctcaaatacaaaaatgtacgcaacaaatttt
gcattgcagcgcttagtcagccaaggaaaacttgacgtctatgaaaaagtttctgcatat
ttgccgggtttcaaggatcagccgggtgacctcataaaaggaaaagacaagatacgtgtc
attgatgtcctccagcaccaatcagggctcccatcaagcttttacttttacacgccggaa
aaagccggcaagtactattcccaagaacgggacaaaacgattgaatatttgacgaaaatt
ccgctcgattatcaaaccgggacaaaacacgtatacagtgacattggatatatgctactc
ggatgtattgtcgaaaaactcaccggcaaaccgcttgatgtctacacggagcaagagctc
tacaaaccgctcaggctgaagcataccttgtacaatccgctgcaaaagggctttaaaccg
aaacagttcgcagctactgaacgcatgggcaatacacgtgacggcgttattcaattccct
aacatccgcacaaacacgctgcaaggagaggtgcatgacgaaaaagcgttttactcaatg
gacggcgtgtctgggcatgccggattgttctcaaatgcagatgatatggccatactgctg
caagtcatgttaaacaaaggttcataccgaaacatttctttatttgatcagaaaacagcc
gacctgtttacagcaccttcagcaacagatccgacattcgctcttggctggaggcggaac
ggaagtaaaagcatggaatggatgtttggccctcatgccagcgaaaatgcttacgggcat
accggctggacggggacagttacaattattgatccagcatacaatttaggcatcgcattg
ttaacaaataaaaagcatacaccagttattgatccggaagaaaatccgaacgtctttgaa
ggtgaccaatttccaacaggcagttatggaagtgtcataaccgcgatttatgaagcgatg
gagtga

DBGET integrated database retrieval system