KEGG   Bacillus subtilis subsp. subtilis 168: BSU02030
Entry
BSU02030          CDS       T00010                                 

Symbol
ybdM
Name
(RefSeq) serine/threonine protein kinase
  KO
K08884  serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU02030 (ybdM)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BSU02030 (ybdM)
Protein kinases [BR:bsu01001]
 Serine/threonine kinases: Other
  Bacterial family
   BSU02030 (ybdM)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 938464
NCBI-ProteinID: NP_388085
Pasteur: BG12726
BSORF: BG12726
UniProt: O31435 A0A6M3Z6X1
LinkDB
Position
complement(223219..223989)
AA seq 256 aa
MALKLLKKLLFDRPLKNGVILNHQYKIEECLGMGGYGLVYLCTDILAQTPYVLKQLRPTK
AKKEKEKVRFQQEIKLLKNIHHPQIPGFIDEFIIDGQAYYVMQFIEGENIEELLFFRKQP
FTELMALQLISQLLEIIEYLHDRLIFHSDIRTPNIIINDGRLCLIDFGLAKQLTPEEMEE
IKVRKQDDFFDLGETLLFLLYSQYKGKKKKNGTWLEELTLTKEVTLLLKRLLGIEEEYQH
TASIREDLNRAIQSVT
NT seq 771 nt   +upstreamnt  +downstreamnt
atggcattaaaacttctaaaaaaactgctatttgaccgccctctaaagaacggcgttatc
ttaaatcatcaatacaaaatcgaagagtgcctcggtatgggaggctacggtttggtttat
ttgtgcaccgatatcctagctcaaacaccttatgtcttaaaacagcttcggccgacaaaa
gccaaaaaggaaaaagagaaagtccgattccagcaggaaataaaactgctcaaaaacatt
caccacccgcaaattccgggcttcatagatgaattcatcatagacggacaggcttattat
gtcatgcagttcattgagggagagaatatagaagaattattattttttcgaaaacagccg
ttcacagagcttatggcgttacaactgatttcgcagctgcttgagattatagaatacctg
catgatcgccttatcttccacagcgacatcagaacgcctaatatcatcatcaatgatggc
aggctctgcctcatcgatttcggccttgccaaacaattgactcctgaagaaatggaggaa
ataaaggtacgaaaacaggatgacttcttcgatctcggagaaacgctgttattcttgctg
tactctcaatataaaggaaaaaagaagaaaaacggcacttggctggaggaattaacactg
acaaaggaagtaaccttgctgctgaaaagattattgggcattgaggaagagtatcagcac
accgcttccattcgcgaggatctaaaccgggccattcaatcggtcacataa

DBGET integrated database retrieval system